KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390442Help
Entry
100390442         CDS       T03264                                 

Gene name
CACNA1B
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04020  Calcium signaling pathway
cjc04721  Synaptic vesicle cycle
cjc04723  Retrograde endocannabinoid signaling
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04930  Type II diabetes mellitus
cjc05032  Morphine addiction
cjc05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100390442 (CACNA1B)
   04020 Calcium signaling pathway
    100390442 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100390442 (CACNA1B)
   04725 Cholinergic synapse
    100390442 (CACNA1B)
   04728 Dopaminergic synapse
    100390442 (CACNA1B)
   04726 Serotonergic synapse
    100390442 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    100390442 (CACNA1B)
   04721 Synaptic vesicle cycle
    100390442 (CACNA1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100390442 (CACNA1B)
   05033 Nicotine addiction
    100390442 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100390442 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100390442 (CACNA1B)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100390442 (CACNA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 100390442
NCBI-ProteinID: XP_002806589
Ensembl: ENSCJAG00000013488
Position
1
AA seq 2338 aa AA seqDB search
MVRFGDNFGGRYGGPGGGERARGGGAGGAGGPGPGGLQPGQRVLYKHSIAQRARTMALYN
PIPVKHNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCEGDTECREYWPGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDRNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTESSSYFRRKEKMFRFFIRRMVK
AQSFYWVVLCVVALNTLCVAMVHYNQPRRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSVFEVVWAAIKPGSSFGISVLRALRLLRIFKVTKYWSSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLRLQNL
RASCEALYSEMDPEERLRFATTRHLRPDMKTHLDRPLVVELGRDGARGTVGGKARQEAAE
VPEGADPPRRHHRHRDKDRAPAAGDQDRAEAPKAESGEPGAREERPRPHRSHSKEAAGPP
EARSERGRGPGPEGGRRHHRRGSPEEVAEREPRRHRTHRHQDPGKEGAGAKGERRARHRG
GPRTGPREAESGEEPARRHRARHKVLPVHEVAEKEAMEKETAEKEAEIVEADKEKELRNH
QPREPHCDLETSGTVTVGPVHTLPSTCLQKVEEQPEDADNQRNVTRMGSQPPDSSTVVHI
PVMLTGPPGEATVVPSGNVDPESQAEGKKEVEADDVMRSGPRPIVPYSSMFCLSPTNLLR
RFCHYIVTMRYFEMVILVVIALSSIALAAEDPVRTDSPRNNALKYLDYIFTGVFTFEMVI
KMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVLRPLK
TIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELER
DCRGQYLDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYE
EQGPSPGYRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACI
DFAISAKPLTRYMPQNRQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYE
LMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIAETNN
FINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQV
FGNIALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSNQACDEQANATECG
SDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAA
CGRISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMALIR
TALEIKLAPAGTKQHQCDAELRKEISIVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMI
FDFYKQNKSTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSL
SNGGAIQNQESGIKESVSWGTQRTQDAPLESRPPLERGHSTEIPVGQSGALAVDVQMQSM
TRRGPDGEPQPGLESQGRAASMPRLAAETQPVADASPMKRSISTLAQRPRGAHLCSTTPD
RPPPSQAPHHHHHRCHRRRDRKQRSLEKGPSLSAETDGAPSSAAGPGLPLGEGPTGCKRE
RERRQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPH
PQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPVHFAGAQTSLP
AFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFE
EAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
NT seq 7017 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcttcggggacaattttggcggccgctatgggggtcctggcggcggggagcgg
gcccggggcggtggggccggcggggcggggggcccgggccccgggggactgcagccgggc
cagcgggtcctctacaagcattcgatcgcgcagcgcgcgcggaccatggcgctgtacaac
cccatcccggtcaagcataattgcttcactgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatacgcgaagcgcatcacggagtggcctccgttcgagtacatg
atcctggccaccatcatcgccaactgcatcgtgctggccctggagcagcacctccctgac
ggggacaagacgcccatgtccgagcggctggacgacacggagccctatttcatcgggatc
ttttgcttcgaggcagggatcaaaatcatcgctctgggctttgtcttccacaagggctct
taccttcggaacggctggaatgtcatggacttcgtggttgtcctcacagggatccttgcc
acggctggaactgactttgacctgcgaacactgagggctgtacgtgtgctgaggcccctg
aagctggtgtctgggattccaagtttgcaggtggtgctcaagtccatcatgaaggccatg
gttccactcctgcagatcgggctgcttctcttctttgccatcctcatgtttgccatcatt
ggcctggagttctacatgggcaagttccacaaggcctgtttccccaacagcacagatgca
gagcctgtgggtgacttcccctgtggcaaggaggccccagcccggctgtgcgagggtgac
actgagtgccgggagtactggccaggacccaactttggcatcaccaacttcgacaacatc
ctgtttgccatcttgacggtgttccagtgcatcaccatggagggctggaccgacatcctc
tacaacacaaacgatgcagccggcaacacctggaactggctctacttcatccctctcatc
atcatcggctccttcttcatgctcaacctggtgctgggagtgctctcgggggagtttgcc
aaggagcgagagagggtggagaaccgccgcgccttcctgaagctgcgccggcagcagcag
atcgagcgagagctcaacgggtacctggagtggatcttcaaggcggaggaagtcatgctg
gccgaggaggacaggaacgcagaggagaagtcccctttggacgtgctgaagagagcagcc
accaagaagagcagaaatgacctgatccacgcagaggagggggaggaccggtttgcagat
ctatgtgctgttggatcccccttcgcccgtgccagccttaagagcgggaagacagagagc
tcgtcatacttccggaggaaggagaagatgttccggtttttcatccggcgcatggtgaag
gctcagagcttctactgggtggtgctgtgtgtggtcgccctgaacacactgtgcgtggcc
atggtgcattacaaccagccgcggcggctcaccacggcactgtattttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctggggcctagaagc
tacttccggtcttccttcaactgcttcgactttggggtcatcgtggggagtgtctttgaa
gtggtctgggcagccatcaagccgggaagctcctttgggatcagtgtgctgcgggccctc
cgtctgctaaggatcttcaaagtcacgaagtactggagctccctgaggaacctggtggtg
tccctgctgaactccatgaagtccatcatcagcctgctcttcctgctcttcctgttcatt
gtggtctttgccctgctggggatgcagctgtttgggggacagttcaacttccaggatgag
actcccacaaccaacttcgataccttccctgccgccatcctcactgtcttccagatcctg
acgggagaggactggaatgcagtgatgtatcacgggatcgaatcgcaaggcggcgtcagc
aaaggcatgttctcgtccttttacttcattgtcctgacactgtttggaaactatactctg
ctgaatgtcttcctggccattgctgtggacaacctggccaatgcccaggagctgactaag
gatgaagaggagatggaagaagcagccaatcagaagcttgctctgcaaaaggccaaagaa
gtggccgaagtcagccccatgtctgctgcgaacatttccatcgctgccaggcagcagaac
tcggccaaggcgcgctcggtgtgggagcagcgggccagccagctacggctgcagaaccta
cgggccagctgcgaggcgctgtacagtgagatggaccccgaggagcggctgcgcttcgcc
accacgcgccacctgcggcccgacatgaagacgcacctggaccggcctctggtggtggag
ctcggccgcgacggcgcgcgggggaccgtgggaggcaaggcccggcaggaggctgcggag
gtacccgagggcgccgacccgccgcgcaggcaccaccggcatcgtgacaaggacagggcc
ccagcagcaggggaccaggaccgagcagaggccccaaaggcggagagtggggagcccggt
gcccgggaggagcggccgcggccgcaccgcagccacagcaaggaggccgcggggcccccg
gaagcgcggagcgagcgtggccgaggcccaggcccggagggcggccggcggcaccatcgg
cgcggctccccggaggaggtggccgagcgggagccccgacgccaccgcacgcaccggcac
caggacccgggcaaggagggcgccggggccaagggcgagcggcgcgcgcgtcaccgcgga
ggccccagaacggggccacgggaggcggagagtggggaggagccggcgcggcggcaccga
gcccggcacaaggtgctacctgtgcacgaggttgctgagaaggaggccatggagaaggag
accgcagagaaggaggctgagatcgtggaagccgacaaggagaaggagctccggaaccac
cagcctagggagccacactgtgacctagagaccagtgggacagtgactgtgggccctgtg
cacacactacccagcacctgtctccagaaggtggaggaacagccagaggatgcagacaat
cagcggaatgtcactcggatgggcagtcagcccccagactcaagcactgttgtacacatc
ccagtgatgctgacgggccctcctggggaagccacggttgttcccagtggtaacgtggac
ccggagagccaagcagagggaaagaaggaggtggaagcggatgacgtgatgaggagcggc
ccccggcccatcgtcccgtacagctccatgttctgtttaagccccaccaacctgctccgc
cgcttctgccactacattgtgaccatgaggtacttcgagatggtcattcttgtggtcatt
gccttgagcagcatcgccctggccgctgaggacccagtgcgcaccgactcacccaggaac
aatgctctgaaatacctggattacattttcactggtgtctttacctttgagatggtgata
aagatgatcgacttgggactgctgcttcaccctggggcctatttccgggacttgtggaac
attctggacttcattgtggtcagtggcgccctggtggcatttgctttctcaggatccaaa
gggaaagacatcaataccatcaagtccctgagagtccttcgtgtcctgcggcccctcaag
accatcaaacggctgcccaagctcaaggctgtgtttgactgtgtggtgaactccctgaag
aacgtcctcaacatcttgattgtctacatgctcttcatgttcatatttgccgtcattgcg
gtacagctcttcaaagggaagtttttctactgcacagatgaatccaaggagctggagagg
gactgcaggggtcagtatttggattatgagaaggaggaagtggaagctcagcccaggcag
tggaagaaatatgactttcactacgacaatgtgctctgggctctgctgacgctgttcaca
gtgtccacgggagaaggctggcccatggtgctgaaacactccgtggatgccacctatgag
gagcaggggccgagccctgggtaccgcatggagctgtccatcttctacgtggtctacttt
gtggtctttcccttcttcttcgtcaacatctttgtggccttgatcatcatcaccttccag
gagcagggggacaaggtgatgtctgaatgcagcctggagaagaatgagagggcctgcatt
gacttcgccatcagcgccaaacccctgacacggtacatgccccagaacaggcagtcgttc
cagtacaagacgtggacatttgtggtctccccgccctttgagtacttcatcatggccatg
atagctctcaacacagtggtgctgatgatgaagttctatgatgcaccctatgagtacgag
ctgatgttgaaatgcctgaacattgtgttcacatccatgttctccatggaatgcgtgctg
aagattattgcctttggggtgctgaactatttcagagatgcctggaatgtctttgacttt
gtcactgtgttgggaagtattactgatattttagtaacagagattgcggaaacgaacaat
ttcatcaacctcagcttcctccgcctcttccgagctgcgcggctgatcaagctgctccgc
cagggctacaccatccgcatcctgctgtggaccttcgtgcagtccttcaaggccctgccc
tacgtgtgtctgctcatcgccatgctgttcttcatctacgccatcatcggcatgcaggtc
tttgggaatatcgccctggatgatgacaccagcatcaaccgacacaacaacttccggacg
tttctgcaagccctgatgctgctgttcaggagcgccacgggggaggcctggcacgagatc
atgctgtcctgcctgagcaaccaggcctgtgacgagcaggccaacgccaccgagtgtggg
agtgactttgcctacttctacttcgtctccttcatcttcctgtgctcctttctgatgttg
aacctctttgtggctgtgatcatggacaattttgagtaccttacgcgggactcttccatc
ctaggtcctcaccacttggacgagttcatccgggtctgggctgagtacgacccagctgcg
tgtgggcgaatcagttacaatgacatgtttgagatgctgaaacacatgtccccgcctctg
gggctggggaagaaatgccctgctcgagttgcctacaagcgcctggttcgcatgaacatg
cccatctccaatgaggacatgaccgtccacttcacgtccacgctgatggccctcatccgg
acggcgctggagattaagctggccccagctgggacaaagcagcatcagtgtgacgcggaa
ttgaggaaggagatttccattgtgtgggccaatcttcctcagaagactctggacctgctg
gtaccaccccataagcctgatgagatgacagttgggaaagtttatgcagctctgatgata
tttgacttctacaagcagaacaaaagcactagagaccagatgcagcaggctcccggaggc
ctctcccagatgggtcctgtgtccctgttccaccctttgaaggccaccctggagcagacg
cagccagctgtgctccgaggagcccgggttttccttcgacagaagagttccacctccctc
agcaatggtggggccatacagaaccaagagagtggcatcaaggagtctgtctcctggggc
actcagaggacccaggatgcaccccttgagtccaggccacccctggagcgtggccactcc
acagagattcctgtggggcagtcaggagcactggctgtggatgttcagatgcagagcatg
acccggaggggccccgatggggagccacagcctggtttggagagccagggccgagcagcc
tccatgccccgccttgctgccgagactcagcccgtcgcagatgccagccccatgaagcgc
tccatctccacgctggcccagcgcccccgcggggctcatctctgcagcaccaccccagac
cgcccaccccctagccaggcaccgcaccaccaccatcaccgctgccaccgccgcagggac
aggaagcagaggtccctggagaaggggcccagcctgtctgccgagacggatggcgcacca
agcagtgctgcggggccggggctgcccctgggagaggggcccacaggctgcaagcgggag
cgagagcgccggcaggagcggggccggtcccaggagcggaggcagccctcatcctcctcc
tcagagaagcagcgcttctactcctgtgaccgctttgggggccgtgagcccccaaagccc
aagccctccctcagcagccaccccacatcaccgacagctggccaggagccaggaccccac
ccccagggcagtggttccgtgaacgggagccccttgctgtcgacatctggtgctagcacc
cctgggcgcggtggacggaggcagctcccccagacgcccttgactcctcgccccagtatc
acctacaagacggccaactcctcacctgtccacttcgccggggcccagaccagcctccct
gccttctccccgggccggctcagccgtgggctttccgaacacaatgccctgctccagaga
gaccccctcagccagcccctggcccctggctctcggatcggctccgacccttacctgggg
cagcgtctggacagtgaggcctctgtccacgccctgcctgaggacacgctcaccttcgag
gaggctgtggccaccaactcgggccgctcctctaggacttcttatgtgtcctccctgacc
tcccagtctcaccctctccgccgcgtgcccaatggctaccactgcaccctgggactcagc
tcaggaggccgagcacggcacagctaccaccaccctgaccaagaccactggtgctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390599Help
Entry
100390599         CDS       T03264                                 

Gene name
CACNA1A
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04020  Calcium signaling pathway
cjc04721  Synaptic vesicle cycle
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04742  Taste transduction
cjc04930  Type II diabetes mellitus
cjc05032  Morphine addiction
cjc05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100390599 (CACNA1A)
   04020 Calcium signaling pathway
    100390599 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100390599 (CACNA1A)
   04727 GABAergic synapse
    100390599 (CACNA1A)
   04725 Cholinergic synapse
    100390599 (CACNA1A)
   04728 Dopaminergic synapse
    100390599 (CACNA1A)
   04726 Serotonergic synapse
    100390599 (CACNA1A)
   04730 Long-term depression
    100390599 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    100390599 (CACNA1A)
   04721 Synaptic vesicle cycle
    100390599 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    100390599 (CACNA1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100390599 (CACNA1A)
   05033 Nicotine addiction
    100390599 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100390599 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100390599 (CACNA1A)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100390599 (CACNA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Motif
Other DBs
NCBI-GeneID: 100390599
NCBI-ProteinID: XP_017822774
Ensembl: ENSCJAG00000004458
Position
22
AA seq 2522 aa AA seqDB search
PDTPFEYMILATIIANCIVLALEQHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIAL
GFAFHKGSYLRNGWNVMDFVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVV
LKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGTDDIQSESPAPCGTE
EPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTW
NWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEW
ISKAEEVILAEDETDGEQRHPFDGNCSEPTSGVGPRGDGRSWGGESGESRRPGCKDPPAG
GRPSWRNCQTSCRVSLFRPPLFCFNHKPDFFCFAPLTVKGCCVPYLCLGCTLVNFFYGNS
LSLTFSIFSLAGSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVA
LNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGV
IIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLL
FLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYDGI
KSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFWAIAVDNLANAQELTKDEQEEEEAASQKL
ALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTSEMRKQNLLASREALYNEM
DPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDF
LQETGRYTTWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEPRRHRAHRRPGE
DGPEDKAERRARHREGSRPARGGEGEGPDGGERRRRHRHGAPATYEGDARREDKERRHRR
RKENQGSGVPVCGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAGPHDSLGHS
GLPQSPAKMGNSTDPGPTPAGPAMATNPQNAASRRTPNNPGNPSNPGPPKTPENSLIVTN
PSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPPSKKEEEKKEEEEDG
GGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQP
NAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFA
FTSSTRGNSKGKDINTIKSFRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYM
LFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDN
VLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNI
FVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNRQSFQYRMWQFVVS
PPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGILNY
FRDAWNIFDFVTVLGSITDILVTEFGNPNNFINLSFLRLFRAARLIKLLRQGYTIRILLW
TFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDDFQITEHNNFRTFF
QALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLML
NLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHYKDMYSLLRVISPPL
GLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAEL
RKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQDR
TPLMFQRMEPPSPTQEAGPGQNALPSTQLDPGGALMAHESGLKESPSWVTQRAQEMFQKT
GTWSPERGPPTDMPNSQPNSQSVEMRAMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQR
RRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVLPEENQRHHQRRRDRGHRA
SERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRHHHHHHHHPPPPDK
DRYAQERPDHGRARARDQRWSRSPSEGREHMTHRQGSSSVSGSPAPSTSGTSTPRRGRRQ
LPQTPSTPRPHVSYSPVIRKAGGSGPPQQQQAVARPGRAATSGPRRYPGPVAEPLAGDRP
PMGGHSSGRSPRMERRVPGPARNESPRACRHGGARWPASGPHVSEGAPGSPAPWLLPRLR
LRRGGRPGKRGRRGGHGRGLRRATPRTTRVLGRHGALTQDSPGLGPGLRLAFPAPATPQR
LLPGAWTGQAPRARLQEGPARTLQRERRRLVLSPGEVAPARPPTHPTHTPHLRSRAEAAG
AQHRGPRRGQGHKSVLQRSSARRDPPGQPRLPPPNPDPPPTHYRGSRVGGRGRQTIQPRD
LN
NT seq 7569 nt NT seq  +upstreamnt  +downstreamnt
cctgatactccctttgaatacatgattttagccaccatcatagcgaattgcatcgttctc
gcactggagcagcatctgcctgatgacgacaagaccccgatgtctgaacggctggatgac
acagaaccatacttcattgggattttttgtttcgaggctggaattaaaatcattgccctt
gggtttgccttccacaaaggctcctacctgaggaatggctggaacgtcatggacttcgtg
gtggtgctaacgggcatcttggcgacagttgggacagagtttgacctgcggacgctgagg
gcagttcgagtgctgcggccgctcaagctggtgtctggaatcccaagtttacaagtcgtc
ctgaagtcgatcatgaaggcgatgatccctttgctgcagattggcctcctcctgtttttt
gcaatccttatttttgcaatcatagggttagaattttatatgggaaaatttcataccacc
tgctttgaagaggggacagatgacattcagagtgagtctccggctccatgtgggacagaa
gaacccgcccgcacctgccccaatgggaccaaatgtcagccctactgggaagggcccaac
aatgggatcactcagttcgacaacattctgttcgcagtgctgactgttttccagtgcata
accatggaagggtggactgatctcctctacaatagcaacgatgcctcagggaacacttgg
aactggttgtacttcatccccctcatcatcatcggctccttttttatgctgaaccttgtg
ctgggtgtgctgtcaggggagtttgccaaagaaagagaacgggtggagaaccggcgggct
tttctgaagctgaggcggcaacaacagattgaacgtgagctcaatgggtacatggagtgg
atctcaaaagcagaagaggtgatcctcgccgaggatgaaactgacggggagcagaggcat
ccctttgatggtaactgctctgaacccacctcgggggtgggtcccaggggcgatgggaga
agctggggtggggagtcaggggagagcaggcgacctggctgtaaggatcctccagcgggt
ggacgtccctcctggaggaactgtcagacttcatgcagggtttccctattccggcctcca
cttttttgctttaatcacaagcctgacttcttctgctttgcgcctttgactgtgaaaggc
tgctgtgtcccatatctgtgcttgggctgcacattggttaatttcttctacgggaacagc
ctgagcctgacattctccatcttttccctggcaggttctcccttcgcccgagccagcatt
aaaagtgccaagctggagaactcgaccttttttcacaaaaaggagaggaggatgcgtttc
tacatccgccgcatggtcaaaactcaggccttctactggactgtactcagtctggtagct
ctcaacacgctgtgtgttgctattgttcactacaaccagcccgagtggctctcagacttc
ctttactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatg
tatgggcttgggacacggccttacttccactcttccttcaactgctttgactgtggggtt
atcattgggagcatcttcgaggtcatctgggccgtcataaaacctggcacatccttcgga
atcagcgtgttacgagccctcaggttattgcgtattttcaaagtcacaaagtactgggca
tctctcagaaacctggtcgtctctctcctcaactccatgaagtccatcatcagcttgttg
ttccttctcttcctcttcattgtcgtcttcgcccttttgggaatgcagctcttcggcggc
cagtttaatttcgatgaagggactcctcccaccaacttcgatactttcccagcagcaata
atgacggtgtttcagatcctgacgggcgaagactggaacgaggtcatgtacgacgggatc
aagtctcaggggggcgtgcagggcggcatggtgttctccatctatttcattgtactgaca
ctcttcgggaactacaccctcctgaatgtgttctgggccatcgctgtggacaatctggcc
aacgctcaggagctcaccaaggacgaacaagaggaagaagaagcagccagccagaaactt
gctctacagaaagccaaagaggtggcggaagtgagtcctctgtcggcggccaacatgtcc
atcgctgtgaaagagcaacagaagaatcaaaagccagccaagtccgtgtgggagcagcgg
accagtgagatgcgaaagcagaacctgctggccagccgggaggccctgtacaacgaaatg
gacccggacgagcgctggaaggccgcctacacccggcacctgcggccggacatgaagacg
cacctggaccggccgctggtggtggacccgcaggagaaccgcaacaacaacaccaacaag
agccgggcggccgagcccacggtggaccagcgcctcggccagcagcgcgccgaggacttc
cttcaggaaacaggccgctacacgacgtgggagggcgaggccgagcggggcaaggccggg
gacccccaccgaaggcacgtgcaccgccaggggggcagcagggagagccgcagcgggtcc
ccgcgcacgggcgcggacggggagccccgacggcaccgcgcgcaccgcaggcccggggag
gacggccccgaggacaaggcggagcggagggcgcggcaccgcgagggcagccggccggcc
cggggcggcgagggcgagggccccgacggcggcgagcgcaggaggcggcaccggcacggc
gctccggccacctacgagggggacgctcggagggaggacaaggagcggaggcatcggagg
aggaaagagaaccagggttctggggtccctgtgtgtggccccaacctgtcaaccacacgg
ccgatccagcaggacctgggccgccaagacccacccctggcagaggacattgacaacatg
aagaacaacaagctggccacagcggagtcggccggtccccacgacagcctcggccactcc
ggcctgccccagagcccggccaagatgggaaacagcaccgaccccggccccacaccggcc
ggccctgccatggccaccaacccccagaacgccgccagccgccggacacccaacaacccg
gggaacccgtccaatcccggcccccccaaaacccccgagaacagccttatcgtcaccaac
cccagcggcacccagaccaattcagctaagactgccaggaaacccgaccacaccaccgtg
gacatccccccggcctgcccaccccccctcaaccacaccgtcgtgcaagtgaacaaaaac
gccaatccagacccaccgtcaaaaaaagaggaagagaagaaggaggaggaggaagacggc
ggcggggaagacggccctaagccgatgcctccgtacagctccatgttcatcctgtccaca
accaacccccttcgccgcctgtgccattacatcctgaacctgcgctactttgagatgtgc
atcctcatggtcattgccatgagcagcatcgccctggccgccgaggaccctgtgcagccc
aacgcgcctcggaacaacgtgctgcgatattttgactacgtttttacaggcgtctttacc
tttgagatggtgatcaagatgatcgacctggggctcgtcctgcatcagggtgcctacttc
cgcgacctctggaatattctcgacttcatagtggtcagtggggccctggtagcctttgcc
ttcacgagcagtacacgtggcaatagcaaaggaaaagacatcaacacgatcaaatccttc
cgagtcctccgggtgctacgacctcttaaaaccatcaagcggttgccgaagctcaaggct
gtgtttgactgcgtggtgaactccctcaagaacgtcttcaacatcctcatcgtgtacatg
ctgttcatgttcatcttcgccgtggtggctgtgcagcttttcaaggggaagttcttccac
tgcactgacgagtccaaggagtttgagaaagattgtcgaggcaaatacctcctctacgag
aagaatgaggtgaaggcacgagatcgggagtggaagaagtacgaattccattacgacaac
gtgctgtgggctctgctgaccctcttcactgtgtccacgggagaaggctggccgcaggtc
ctcaagcactcagtggatgccacctttgagaaccagggccccagccccgggtaccgcatg
gagatgtccattttctacgtcgtctactttgtggtgttccctttcttcttcgtcaatatc
tttgtggccttgatcatcatcaccttccaggagcaaggggacaagatgatggaggaatac
agcctggagaaaaatgagagggcctgcatcgatttcgccatcagtgccaagccactgacc
cgacacatgccacagaacaggcagagcttccagtaccgcatgtggcagttcgtggtatct
ccgcctttcgagtacacgatcatggccatgatcgccctcaacaccatcgtgcttatgatg
aagttctacggggcctctgttgcttatgaaaacgcgctgagggtgttcaacatcgtcttc
acctccctcttctctctggaatgtgtgctgaaagtcatggcttttgggattctgaattac
ttccgcgatgcctggaacatcttcgactttgtgactgttctgggcagcatcaccgatatc
ctcgtgactgagtttgggaatccgaataacttcatcaacctgagctttctccgcctcttc
cgagctgcccggctcatcaaacttctccgtcagggttacaccatccgcattcttctctgg
acctttgtgcagtccttcaaggccctgccttatgtgtgtctgctgatcgccatgttgttc
ttcatctatgccatcatcgggatgcaggtgtttggcaacattggcatcgacgtggaggat
gaggacagtgacgaagatgatttccaaatcactgagcacaataacttccggaccttcttc
caggccctcatgctgcttttccggagtgccaccggggaagcgtggcacaacatcatgctc
tcctgcctcagcgggaaaccctgtgataaaaactctggcatcctgactcgagagtgtggc
aatgaatttgcttatttttacttcgtttccttcatcttcctctgctcatttctgatgctg
aatctctttgtcgccgtcatcatggacaattttgagtacctcacccgagactcctccatc
ctgggcccccaccacctggatgagtacgtgcgtgtctgggccgagtatgaccctgcagct
tgcggtcggattcattataaggatatgtacagtttattgcgagtaatatctccccctctc
ggcttaggcaagaaatgtcctcatagggttgcttgcaagaggcttctgcggatggacctg
cccgtggcagatgacaacaccgtccacttcaattccaccctcatggctctgatccgcaca
gccctggacatcaagattgccaagggaggagccgacaaacagcagatggacgccgagctg
cggaaggagatgatggcgatttggcccaacttgtcccagaagacactggacctgctggtc
acccctcacaagtccacggacctcacggtggggaagatctatgcagccatgatgatcatg
gagtattaccgccagagcaaggccaagaagctgcaggccatgcgtgaggagcaggaccgg
acacccctcatgttccagcgcatggagcccccatccccaacgcaagaggcggggcccggc
cagaatgcccttccctccacccagctggacccaggaggagccctgatggctcatgaaagc
ggcctcaaggaaagcccatcctgggtgacccagcgtgcccaggaaatgttccagaagaca
ggcacgtggagcccggagcgaggccccccaaccgacatgcccaacagccagcctaactct
cagtccgtggagatgcgagcaatgggcagagatggctactctgacagcgagcactacctc
cccatggaaggccagggccgggccgcctccatgccccgcctccctgcagagaaccagagg
aggaggggccggccacgtgggaataacctcagtaccatctcagacaccagccccatgaag
cgctcagcctccgtgctgggccccaaggcccggcgcctggacgactattcgctggagcgg
gtcctgcccgaggagaaccagcggcaccaccagcggcgccgcgaccgcggccaccgtgcc
tcggagcgctccctgggccgctacaccgacgtagacacaggcttggggacagacctgagc
atgaccacccaatcgggggacctgccatccaaggagcgggaccaggagcggggccggccc
aaggatcggaagcatcgacaccaccaccaccaccaccaccaccccccgccacccgacaag
gaccgctatgcccaggaacggccggaccacggccgggcacgggcccgggaccagcgttgg
tcccgctcccccagcgagggccgagagcacatgacacaccggcagggcagtagttccgta
agtggaagcccagccccctcaacatctggtaccagcactccgcggcggggccgccgccag
ctcccccagaccccttccaccccccggccacacgtgtcctattcccctgtgatccgtaag
gccggtggctcggggcccccgcagcagcagcaggcggtggccaggccgggccgggcagcc
accagcggccctcggaggtacccaggccccgtggccgagcctctggccggagatcggccg
cccatggggggccacagcagcggccgctcgcccaggatggagcggcgggtcccgggccca
gcccggaacgagtctcccagggcctgtcgccatggcggggcccggtggccggcatccggc
ccgcacgtgtccgaaggggcccccgggtccccggcaccatggctactaccgaggctccga
ctacgacgaggcggacggcccgggaagcgggggcggcgaggaggccatggccggggccta
cgacgcgccaccccccgcacgacacgcgtcctcgggcgccacggggcgctcacccaggac
tccccgggcctcgggcccggcctgcgcctcgccttcccggcaccggcgactccccaacgg
ctactacccggcgcatggactggccaggccccgcgggccaggctccaggaagggcctgca
cgaaccctacagcgagagcgacgacgattggtgctaagcccgggcgaggtggcgcccgcc
cggccccccacgcaccccacgcacacaccccacctgaggagccgcgcagaggctgcgggg
gcccagcacagagggcccaggagaggccagggccacaagagtgtcctgcagagatcctca
gccagaagagaccctcctgggcagccacggctccctccacccaaccccgatccccccccc
acccactacaggggctctcgggtgggaggcaggggcagacaaaccatacagccaagggat
ttgaattaa

DBGET integrated database retrieval system