KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390533Help
Entry
100390533         CDS       T03264                                 

Gene name
DNM1L
Definition
(RefSeq) dynamin 1 like
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100390533 (DNM1L)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100390533 (DNM1L)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100390533 (DNM1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100390533 (DNM1L)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100390533 (DNM1L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100390533 (DNM1L)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     100390533 (DNM1L)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    100390533 (DNM1L)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100390533 (DNM1L)
   RhoA-dependent endocytosis
    100390533 (DNM1L)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100390533 (DNM1L)
   Retention of mitochondria
    100390533 (DNM1L)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100390533 (DNM1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_16 FtsK_SpoIIIE AAA_28
Motif
Other DBs
NCBI-GeneID: 100390533
NCBI-ProteinID: XP_002807133
Ensembl: ENSCJAG00000018143
UniProt: U3BXM6
Position
9
AA seq 710 aa AA seqDB search
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDSRRE
TKTVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLL
DVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSEL
VGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctaattcctgtcattaacaagctccaggacgtcttcaatacggtgggcgcc
gacatcatccagctgcctcaaatcgtcgtagtgggaacgcagagcagtggaaagagctca
gtgctagaaagcctggtggggagggacttgcttcccagaggtactggaattgtcacccgg
agacctctcattctgcaactggtccatgtttcacaagaagataaacgaaaaacaacagga
gaagaaaatggggtggaagcagaagaatggggtaaatttcttcacaccaaaaataagctt
tacacggattttgatgaaattcgacaggaaattgaaaatgaaacagaacgaatatcggga
aataataagggagtaagccctgaaccaattcatcttaagattttttcacccaatgttgtc
aatttgacacttgtggatttgccaggaatgaccaaggtgcctgtaggtgatcaacctaag
gatattgagcttcagatcagagagctcattcttcggttcatcagtaacccaaattccatt
atcctggctgtcactgctgctaacacagatatggcaacatcagaggcacttaaaatttca
agagaggtagatccagatggtcgcagaaccctagctgtaatcactaaacttgatctcatg
gatgcgggtaccgatgccatggatgtattgatgggaagggttattccagtcaagcttgga
ataattggagtagttaacaggagccagctagatattaacaacaagaagagtgtaactgat
tcaatccgtgatgagtatgcttttcttcaaaagaaatatccatctctggccaatagaaat
ggaacaaaatatcttgctaggactctaaacaggttactgatgcatcacatcagagattgc
ttaccagagttgaaaacaagaataaatgttctagctgctcagtatcagtctcttctaaat
agctacggtgaacctgtggatgataaaagtgctactttactccagcttattaccaaattt
gccacagaatattgtaacactattgaaggaactgcaaaatatattgaaacttcggagcta
tgcggtggtgctagaatttgttatattttccatgagacttttgggcgaaccttagaatct
gttgatccacttggtggccttaacactattgacattttgactgccattagaaatgctact
ggtcctcgtcctgctttgtttgtgcctgaggtttcatttgagttactggtcaagcggcaa
atcaaacgtttagaagagcccagcctccgctgtgtagaactggttcatgaggaaatgcaa
aggatcattcagcactgtagcaattacagtacacaggaattgttacgatttcctaaactt
cacgatgccatagttgaagtggtgacttgtcttcttcgtaaaagattgcccgttacaaat
gaaatggtccataacttagtggcaattgaactggcttatatcaacacaaaacatccggac
tttgctgatgcttgtgggctaatgaataataatatagaggaacaaaggagaaacaggcta
gccagagaattaccttcagctgtatcacgagacaagttaattcaggacagcagaagagaa
actaaaactgttgcatctggaggtggtggggttggagatggcgttcaagaaccaacaaca
ggcaactggagaggaatgttgaagacttcaaaagctgaagagttattagcagaagaaaaa
tcaaaacccattccaattatgccagccagtccacagaaaggtcatgctgtgaatctgctg
gatgtgccagttcctgttgcacgaaaactatctgctcgggaacagcgagactgtgaggtt
attgaacgactcatcaaatcatattttctcattgtcagaaagaatattcaagacagtgtg
ccaaaggcagtaatgcattttttggttaatcatgtgaaagacactcttcagagtgagcta
gtaggccagctgtataaatcatccttattggatgatcttctgactgaatctgaggacatg
gcacagcgcaggaaagaagcagctgatatgctaaaggcattacaaggagccagtcaaatt
attgctgaaatccgagagactcatctttggtga

DBGET integrated database retrieval system