KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390586Help
Entry
100390586         CDS       T03264                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04380  Osteoclast differentiation
cjc04390  Hippo signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100390586 (TGFB2)
   04350 TGF-beta signaling pathway
    100390586 (TGFB2)
   04390 Hippo signaling pathway
    100390586 (TGFB2)
   04068 FoxO signaling pathway
    100390586 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390586 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100390586 (TGFB2)
   04218 Cellular senescence
    100390586 (TGFB2)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    100390586 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390586 (TGFB2)
   05206 MicroRNAs in cancer
    100390586 (TGFB2)
   05205 Proteoglycans in cancer
    100390586 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100390586 (TGFB2)
   05212 Pancreatic cancer
    100390586 (TGFB2)
   05225 Hepatocellular carcinoma
    100390586 (TGFB2)
   05226 Gastric cancer
    100390586 (TGFB2)
   05220 Chronic myeloid leukemia
    100390586 (TGFB2)
   05211 Renal cell carcinoma
    100390586 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100390586 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    100390586 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100390586 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    100390586 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100390586 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100390586 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100390586 (TGFB2)
   05161 Hepatitis B
    100390586 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100390586 (TGFB2)
   05144 Malaria
    100390586 (TGFB2)
   05145 Toxoplasmosis
    100390586 (TGFB2)
   05140 Leishmaniasis
    100390586 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    100390586 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100390586 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100390586 (TGFB2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100390586 (TGFB2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   100390586 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 100390586
NCBI-ProteinID: XP_002760553
Ensembl: ENSCJAG00000012931
UniProt: F7G0A3
Position
19
AA seq 414 aa AA seqDB search
MHYCVLRAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQRTLKSNRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagggcttttctgatcctgcatctggtcacggtcgcgctcagt
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaattgtccgatttgatgtctcagcaatggagaagaac
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgaacaacggatcgagctgtatcagattctcaagtccaaagatttaacatctcca
acccagcgctacatcgacagcaaagtcgtgaaaacaagagcggaaggcgaatggctctct
tttgatgtaactgatgctgttcatgaatggcttcaccataaagacaggaacctgggattt
aaaataagcttacactgtccctgttgtacttttgtgccatcgaataactacatcatccca
aataaaagcgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagagaactctaaagtccaataggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttattgccctcctacagacttgagtcacaacagaccaaccgacggaag
aagcgtgctttggatgcagcctattgctttagaaatgtgcaggacaattgctgcctacgc
ccactttacattgatttcaagagggatcttgggtggaaatggatacacgaacccaaaggg
tacaatgccaacttctgtgctggagcatgcccatatttatggagttcagacactcagcac
agcagggtcctgagcttatacaataccataaatccagaagcatctgcttctccctgctgc
gtgtcccaagatttagaacctctaaccattctctactacatcggcaaaacacccaagatt
gaacagctttctaatatgattgtgaagtcttgcaaatgcagctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392463Help
Entry
100392463         CDS       T03264                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04390  Hippo signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100392463 (TGFB3)
   04350 TGF-beta signaling pathway
    100392463 (TGFB3)
   04390 Hippo signaling pathway
    100392463 (TGFB3)
   04068 FoxO signaling pathway
    100392463 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100392463 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100392463 (TGFB3)
   04218 Cellular senescence
    100392463 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392463 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100392463 (TGFB3)
   05212 Pancreatic cancer
    100392463 (TGFB3)
   05225 Hepatocellular carcinoma
    100392463 (TGFB3)
   05226 Gastric cancer
    100392463 (TGFB3)
   05220 Chronic myeloid leukemia
    100392463 (TGFB3)
   05211 Renal cell carcinoma
    100392463 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100392463 (TGFB3)
   05321 Inflammatory bowel disease (IBD)
    100392463 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100392463 (TGFB3)
   05414 Dilated cardiomyopathy (DCM)
    100392463 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100392463 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100392463 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392463 (TGFB3)
   05161 Hepatitis B
    100392463 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100392463 (TGFB3)
   05144 Malaria
    100392463 (TGFB3)
   05145 Toxoplasmosis
    100392463 (TGFB3)
   05140 Leishmaniasis
    100392463 (TGFB3)
   05142 Chagas disease (American trypanosomiasis)
    100392463 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100392463 (TGFB3)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100392463 (TGFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 100392463
NCBI-ProteinID: XP_002754174
Ensembl: ENSCJAG00000020680
UniProt: F7IQT4
Position
10
AA seq 412 aa AA seqDB search
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMHGEKEEGCTQENTESEYYAKEIHKFDMIQGMTEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIQEVMEIKFKGVDHEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccatcg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcacggggagaaggaggaaggctgcacccaggaaaataccgagtcggaatac
tatgccaaagaaatccacaaattcgacatgatccaggggatgacggaacacaatgagctg
gctgtctgccccaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccagatgagcacatt
gccaaacagcgctatatcggcggcaagaatctgcctacacggggcactgctgagtggctg
tcctttgatgtcactgacactgtgcgcgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcaggaggtgatggaaatcaaattcaaaggcgtggaccatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacatcggcttgacagcccgggccaggggggtcagaggaagaagcgg
gccttggacaccaactactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaaatgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccgtacctgcgcagtgcagacacgacccacagcacg
gtgctgggactgtacaacactctgaatcctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaggtggagcag
ctctccaacatggtggtgaagtcctgtaagtgtagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401979Help
Entry
100401979         CDS       T03264                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04380  Osteoclast differentiation
cjc04390  Hippo signaling pathway
cjc04659  Th17 cell differentiation
cjc04672  Intestinal immune network for IgA production
cjc04926  Relaxin signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05220  Chronic myeloid leukemia
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100401979 (TGFB1)
   04350 TGF-beta signaling pathway
    100401979 (TGFB1)
   04390 Hippo signaling pathway
    100401979 (TGFB1)
   04068 FoxO signaling pathway
    100401979 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100401979 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100401979 (TGFB1)
   04218 Cellular senescence
    100401979 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100401979 (TGFB1)
   04672 Intestinal immune network for IgA production
    100401979 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100401979 (TGFB1)
  09158 Development
   04380 Osteoclast differentiation
    100401979 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401979 (TGFB1)
   05205 Proteoglycans in cancer
    100401979 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100401979 (TGFB1)
   05212 Pancreatic cancer
    100401979 (TGFB1)
   05225 Hepatocellular carcinoma
    100401979 (TGFB1)
   05226 Gastric cancer
    100401979 (TGFB1)
   05220 Chronic myeloid leukemia
    100401979 (TGFB1)
   05211 Renal cell carcinoma
    100401979 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100401979 (TGFB1)
   05321 Inflammatory bowel disease (IBD)
    100401979 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100401979 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    100401979 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100401979 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100401979 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100401979 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100401979 (TGFB1)
   05161 Hepatitis B
    100401979 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100401979 (TGFB1)
   05144 Malaria
    100401979 (TGFB1)
   05145 Toxoplasmosis
    100401979 (TGFB1)
   05140 Leishmaniasis
    100401979 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    100401979 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100401979 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100401979 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100401979 (TGFB1)
Chaperones and folding catalysts [BR:cjc03110]
 Intramolecular chaperones
  Others
   100401979 (TGFB1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100401979 (TGFB1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   100401979 (TGFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 100401979
NCBI-ProteinID: XP_002762206
Ensembl: ENSCJAG00000020149
UniProt: U3D3J1
Position
22
AA seq 390 aa AA seqDB search
MPPSGLRLLPLLLPLLWLLVLTLGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPNQAEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVFMMETRHDI
YDKFKHSTHSIYMFFNTSELREAVPEPALLSRAELRLLRLKLTAEQHVELYQKYSNNSWR
YLSNRLLAPSDSTEWLSFDVTGVVRQWLTHRGEIEGFRLSAHCSCDSQVNTLQVDINGFS
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccgggttgcggctgctgccgctgctgctgccgctgctgtggctactggtg
ctgacgcttggccggccagccgcgggactatccacctgcaagaccatcgatatggagctg
gtgaagcggaagcgcatcgaggccatccgtggccagatcctgtccaagctgcggctcgcc
agccccccgaatcaggcagaggtgccgccgggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagcgccgagccggagcccgagccggag
gccgactactacgccaaggaggtcacccgcgtgttcatgatggaaacccgccacgacatc
tatgacaagttcaagcacagcacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcagtacctgaacccgcgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaacggcggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctactggctcccagcgactcgacggagtggttgtctttcgatgtc
actggagttgtgcgacagtggctgacccacagaggggaaattgaaggctttcgccttagc
gcccactgctcctgtgacagccaagttaacacactgcaagtggacatcaacggattctct
actggccgccgaggtgacctggccaccattcacggcatgaaccggcctttcctgcttctc
atggccacgccgctggagagagcccagcatctgcaaagctcccggcaccgcagagccctg
gacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggaccttggctggaagtggatccacgagcccaagggctaccacgccaac
ttctgcctggggccctgcccctacatttggagcctggacacacagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgtgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcaactgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system