KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390587Help
Entry
100390587         CDS       T03264                                 

Gene name
CXCL8, IL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04218  Cellular senescence
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05144  Malaria
cjc05146  Amoebiasis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05219  Bladder cancer
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100390587 (CXCL8)
   04072 Phospholipase D signaling pathway
    100390587 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390587 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100390587 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100390587 (CXCL8)
   04621 NOD-like receptor signaling pathway
    100390587 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    100390587 (CXCL8)
   04657 IL-17 signaling pathway
    100390587 (CXCL8)
   04062 Chemokine signaling pathway
    100390587 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390587 (CXCL8)
   05202 Transcriptional misregulation in cancer
    100390587 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    100390587 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100390587 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100390587 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100390587 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100390587 (CXCL8)
   05133 Pertussis
    100390587 (CXCL8)
   05134 Legionellosis
    100390587 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    100390587 (CXCL8)
   05161 Hepatitis B
    100390587 (CXCL8)
   05163 Human cytomegalovirus infection
    100390587 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100390587 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100390587 (CXCL8)
   05144 Malaria
    100390587 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    100390587 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100390587 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100390587 (CXCL8)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100390587 (CXCL8)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Chemokines
   100390587 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100390587
NCBI-ProteinID: XP_002745779
Ensembl: ENSCJAG00000013945
UniProt: A0A2R8N9Y1
Position
3
AA seq 101 aa AA seqDB search
MTSKLVLALLAAFLLSATLCEGALMPRSGKELRCQCIKTYSTPFSPKFIKELRVIERGPH
CANTEIIVRLVDGRELCLDPKEKWVQRVVQIFLKRAENQNS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggttctggctctcttggcagccttcctcctttctgcaactctgtgt
gaaggtgcacttatgccaaggagtggcaaagaactgagatgtcagtgcataaagacgtac
tccacacctttctcccccaaatttatcaaagaactgagagttattgagaggggaccacac
tgcgccaatacagaaatcattgtaaggcttgttgatggaagagagctttgtctggacccc
aaggaaaagtgggtgcagagggttgtgcagatatttttgaagagggctgagaatcaaaat
tcataa

DBGET integrated database retrieval system