KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390883Help
Entry
100390883         CDS       T03264                                 

Gene name
TNFRSF25
Definition
(RefSeq) TNF receptor superfamily member 25
  KO
K05160  tumor necrosis factor receptor superfamily member 25
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100390883 (TNFRSF25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100390883 (TNFRSF25)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100390883 (TNFRSF25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6
Motif
Other DBs
NCBI-GeneID: 100390883
NCBI-ProteinID: XP_017829764
Ensembl: ENSCJAG00000000177
Position
7
AA seq 454 aa AA seqDB search
MARGRARAKGGTTTGRADGAGKPLGARRRAQRGAKAMEQRPQGCVTAAVAAALLLVLLVP
QVQGGTRSPRCDCAGDVYKKIGLFCCRGCPAGYYLKAPCMEPCGNSTCLPCPRDSFLAWE
NHHNSECARCQVCDEQASQVALENCSAVADTHCGCKAGWFVECQVSQCISSSPFYCRPCL
DCRALHRHTRLLCSRYDTDCGTCLPGFYEHRDACVSCPTSTLGSCPERCATVCGWRQMFW
VQVLLAGLVFPLLLGATVTYTYRHCWPHKPRVTDEAGMEALTPPLPTHLSPLDSSHTLLA
PSDSNEKISTVQLVGNGWTPGYPQSQEVLCPQVTWSWDQLPNRALGPAPVPTLSPESSAG
SPAVMLQPGPQLYDVMDAVPARRWKEFVRTLGLREAEIEAVEVEIGRFRDQQYEMLKRWR
QQQPAGLGAIYAALERMGLDGCAEDLRSRLQRGP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggggcgggcacgggctaaaggcggaaccacgacgggaagagcggacggagcc
gggaagcccctgggcgcccgtcggagggctcagcgcggcgcgaaggccatggagcagcgg
ccacagggctgcgtgacggcggcggtggctgcggcgcttctcttggtgctgctggtgccc
caggtccagggaggcactcgtagtcccaggtgtgactgtgccggtgacgtctacaagaag
attggtctgttttgttgcaggggctgcccagcggggtactacctgaaggccccctgcatg
gagccctgcgggaactctacctgccttccatgtcctcgagacagcttcttggcttgggag
aaccaccataattctgaatgtgcccgctgccaagtctgtgatgagcaggcctcccaggtg
gccctggagaactgttctgcagtggcagacacccactgtggctgtaaggcaggctggttt
gtggagtgccaggtcagccagtgtatcagcagctcacccttctactgccgaccctgccta
gactgcagggccctgcaccgccacacgaggctactctgttcccgctatgatactgactgt
gggacctgcctgcctggcttctatgaacaccgtgatgcctgcgtgtcctgccccacgagc
accctggggagctgtccagagcgctgtgccactgtctgtggctggaggcagatgttctgg
gtccaggtgctcctggctggccttgtgttccccctcctgcttggggccactgtgacctac
acttaccgccactgctggcctcataagcccagggttactgatgaagctgggatggaggct
ctgaccccaccactgcccacccatctgtcacccttggacagctcccacacccttctagcg
ccttctgacagcaatgagaagatcagcaccgtccagttggtcggcaacggctggacccct
ggctacccccagtcccaggaggtgctctgccctcaggtgacatggtcctgggaccagttg
cccaacagagctcttggccccgctcctgtgcccacgctctcgccggagtcctcagcgggc
tcgccagcagtaatgctgcagcccggcccgcagctctatgacgtgatggacgcggtccca
gcgcggcggtggaaggagttcgtgcgcacgctggggctgcgcgaggcggagatcgaagcc
gtggaggtggagatcggccgcttccgagaccagcagtacgagatgctcaaacgctggcgc
cagcaacagcccgcgggcctgggtgccatctacgcggccctggagcgcatggggctggac
ggctgtgcagaggacttgcgcagccgcctgcagcgcggcccctga

DBGET integrated database retrieval system