KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390922Help
Entry
100390922         CDS       T03264                                 

Gene name
ZAP70
Definition
(RefSeq) tyrosine-protein kinase ZAP-70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100390922 (ZAP70)
   04064 NF-kappa B signaling pathway
    100390922 (ZAP70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100390922 (ZAP70)
   04660 T cell receptor signaling pathway
    100390922 (ZAP70)
   04658 Th1 and Th2 cell differentiation
    100390922 (ZAP70)
   04659 Th17 cell differentiation
    100390922 (ZAP70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100390922 (ZAP70)
  09163 Immune disease
   05340 Primary immunodeficiency
    100390922 (ZAP70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100390922 (ZAP70)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100390922 (ZAP70)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  SYK family
   100390922 (ZAP70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 100390922
NCBI-ProteinID: XP_002757439
Ensembl: ENSCJAG00000011481
Position
14
AA seq 648 aa AA seqDB search
MALGPETRQVACLLGHPPVGPQVWGGAGAMPDPAAHLPFFYGSISRAEAEEHLKLAGMAD
GLFLLRQCLRSLGGYVLSLVHDVSFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDP
DGLPCNLRKPCNRPSGLEPQPGVFDGLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEK
LIATTAHERMPWYHSNLTREEAERKLYSGTQTDGKFLLRPRKEQGTYALSLIYGKTVYHY
LISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNTSGAVAPTLP
AHPSTFTHPQRRMDTLNSDGYTPEPARVTSPDKPRPMPMDTSVYESPYSDPEELKDKKLF
LKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMH
QLDNPYIVRLIGVCRAEALMLVMEMAGGGPLHKFLIGKKEEIPVSNVAELLHQVSMGMKY
LEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECI
NFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPAECPPELYAL
MSDCWIYKWEDRPDFLTVEQRMRACYYSLASKGEGSPGCAQKAEAACA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgggaccagagacccgacaggtggcctgtttgcttgggcatccacctgtaggt
ccccaggtttggggaggcgcaggagcgatgccagaccccgcggcacacctgcccttcttc
tacggcagcatctcgcgcgccgaggccgaggagcacctgaagctggcgggcatggcagat
gggctcttcctgctgcgccagtgcctgcgctcgctgggaggctatgtactgtcgctggtg
cacgacgtgagctttcaccactttcccatcgagcgccagctcaacggcacctacgccatc
gccggcggcaaggcgcactgcggcccggctgagctctgcgagttctactcgcgagacccg
gacgggctgccctgcaacctccgcaagccatgcaaccggccgtcgggcctcgagcctcag
ccgggggtcttcgacggcctgcgcgacgccatggtgcgcgactacgtgcgccagacttgg
aagctggagggcgaggccctggagcaggccatcatcagccaggccccgcaggtggagaag
ctcattgctacgacggcccatgagcggatgccctggtaccacagcaacctgacgcgcgag
gaggccgagcgcaaactttactctgggacgcagaccgacggcaagttcctgctgaggccg
cggaaggagcagggcacgtatgccctgtccctcatctatgggaagacagtgtaccactac
ctcatcagccaggacaaggcgggcaagtactgcattcccgagggcaccaagtttgacacg
ctctggcagctggtggagtatctgaagctgaaggcagacgggctcatctactgcctgaag
gaggcctgccccaacagcagtgccagcaacacctcaggggccgttgctcccacgctccca
gcacacccatctacattcactcaccctcagagacggatggacaccctcaactcagatgga
tacacccctgagccagcccgcgtaacgtccccagacaaaccgcggccgatgcccatggac
acaagtgtatacgagagcccctacagtgacccagaggagctcaaggacaagaagctcttc
ctgaagcgcgataacctcctcatagccgacattgaacttggttgtggcaactttggctca
gtgcgccagggcgtgtaccgcatgcgcaaaaagcagatcgacgtggccatcaaggtgctg
aagcagggcacagagaaggcagacaccgaggagatgatgcgcgaggcacagatcatgcac
cagctggacaacccctacatcgtgcggctcattggcgtctgccgggccgaggccctcatg
ctggtcatggagatggctggtggcgggccactgcacaagttcctcatcggcaagaaggag
gagattcccgtgagcaacgtggcagagctgctgcaccaggtgtccatggggatgaagtac
ttggaggagaagaacttcgtgcaccgtgacctggcggctcgcaatgtcctgctggtcaac
cggcactatgccaagatcagcgactttggcctctccaaagcactgggtgctgatgacagc
tactatactgcccgctcagcagggaagtggcctctcaagtggtacgcacccgagtgcatc
aacttccgcaagttctccagccgcagtgatgtctggagctacggggtcaccatgtgggag
gccttgtcctatggccagaagccctacaagaagatgaaaggtccagaggtcatggccttc
atcgagcagggcaagcggatggagtgcccagcagagtgtccgcccgaactgtacgcactc
atgagtgactgctggatctacaagtgggaggatcggccagacttcctgaccgtggagcag
cgcatgcgggcctgttactacagcctggccagcaaaggcgaggggtccccaggctgtgca
cagaaggccgaggctgcctgtgcctga

DBGET integrated database retrieval system