KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390938Help
Entry
100390938         CDS       T03264                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04114  Oocyte meiosis
cjc04217  Necroptosis
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05031  Amphetamine addiction
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100390938 (CAMK2A)
   04310 Wnt signaling pathway
    100390938 (CAMK2A)
   04066 HIF-1 signaling pathway
    100390938 (CAMK2A)
   04020 Calcium signaling pathway
    100390938 (CAMK2A)
   04024 cAMP signaling pathway
    100390938 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100390938 (CAMK2A)
   04217 Necroptosis
    100390938 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100390938 (CAMK2A)
   04922 Glucagon signaling pathway
    100390938 (CAMK2A)
   04912 GnRH signaling pathway
    100390938 (CAMK2A)
   04921 Oxytocin signaling pathway
    100390938 (CAMK2A)
   04916 Melanogenesis
    100390938 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    100390938 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100390938 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    100390938 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    100390938 (CAMK2A)
   04728 Dopaminergic synapse
    100390938 (CAMK2A)
   04720 Long-term potentiation
    100390938 (CAMK2A)
   04722 Neurotrophin signaling pathway
    100390938 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    100390938 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    100390938 (CAMK2A)
  09158 Development
   04360 Axon guidance
    100390938 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100390938 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390938 (CAMK2A)
   05205 Proteoglycans in cancer
    100390938 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    100390938 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100390938 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100390938 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100390938 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100390938 (CAMK2A)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100390938 (CAMK2A)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100390938 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 100390938
NCBI-ProteinID: XP_008986072
Ensembl: ENSCJAG00000021031
Position
2
AA seq 489 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDXINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagccttctcggtggtgcgaaggtgtgtgaaggtgctggctggccaagagtacgct
gccaagatcatcaacaccaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacatcgtccgactccatgacagcatctcg
gaggagggacaccactacctgatcttcgacctggtcactggtggggaattgtttgaagac
atcgtggcccgggagtattacagtgaggcagatgccagtcactgtatccagcagatcctg
gaggctgtgctgcattgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggcgctgcagtgaagctggcagactttggcctggcc
atagaggtggagggggaacagcaggcatggtttgggtttgcagggactcctggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgttgacttgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccattctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagccggcgcctatgatttcccgtcaccggaatgggacaccgtc
accccagaagccaaggacntgatcaataagatgctaaccattaacccatctaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcgtcctgt
atgcatagacaggagaccgtggactgcctgaagaagttcaacgccaggaggaaactgaag
ggagccattctcaccacaatgctggccaccaggaacttctctggagggaagagtggggga
aacaagaagagcgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacggccttcgaacctgaggccctggggaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagcct
gtgcacactacgatcctgaatccccacatccacctgatgggcgatgagtcggcctgcatt
gcctacatccgcatcacgcagtacctggatgccggcggcatcccccgcaccgcccaatcg
gaggagacccgcgtctggcaccgccgggacggcaaatggcagattgttcacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391424Help
Entry
100391424         CDS       T03264                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04114  Oocyte meiosis
cjc04217  Necroptosis
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05031  Amphetamine addiction
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100391424
   04310 Wnt signaling pathway
    100391424
   04066 HIF-1 signaling pathway
    100391424
   04020 Calcium signaling pathway
    100391424
   04024 cAMP signaling pathway
    100391424
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100391424
   04217 Necroptosis
    100391424
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100391424
   04922 Glucagon signaling pathway
    100391424
   04912 GnRH signaling pathway
    100391424
   04921 Oxytocin signaling pathway
    100391424
   04916 Melanogenesis
    100391424
   04925 Aldosterone synthesis and secretion
    100391424
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100391424
  09154 Digestive system
   04971 Gastric acid secretion
    100391424
  09156 Nervous system
   04725 Cholinergic synapse
    100391424
   04728 Dopaminergic synapse
    100391424
   04720 Long-term potentiation
    100391424
   04722 Neurotrophin signaling pathway
    100391424
  09157 Sensory system
   04740 Olfactory transduction
    100391424
   04750 Inflammatory mediator regulation of TRP channels
    100391424
  09158 Development
   04360 Axon guidance
    100391424
  09159 Environmental adaptation
   04713 Circadian entrainment
    100391424
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391424
   05205 Proteoglycans in cancer
    100391424
  09162 Cancer: specific types
   05214 Glioma
    100391424
  09165 Substance dependence
   05031 Amphetamine addiction
    100391424
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100391424
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100391424
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100391424
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100391424
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100391424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaMKII_AD Pkinase Pkinase_Tyr DUF4440 SnoaL_3 Endomucin
Motif
Other DBs
NCBI-GeneID: 100391424
NCBI-ProteinID: XP_017822543
Position
20
AA seq 347 aa AA seqDB search
MGMVHQDRKPENLLLASKSKGAAMKLVDFGLATEVQGDQQACFGFAGTSGYISPEVLHKD
PYGKPVAMWACGVIPYILLVGCPPFWDENQHRLYQQIKAGAYDFPSPEWDMVTPKAKDLI
NKMLTTNPAKCITASEALKHPWICQHSAVASTMHRQETIDCFKKFNARRKLKGPILTTMV
ATRNFSVAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEITKATGQLVEAINNGDFEAH
RKVCDPGLTAFEPEALGKLVEGMDFHQFYFESALPQSTKPIHTIILNPHVHLVRDDAACK
TLYTQYMDGSGMPRTMQAEETRVWHRRDAKWQNVHFHRLWSPAVPTN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggtccatcaggaccggaagcctgagaatttgcttttagctagcaaatccaag
ggagcagctatgaaactggtagactttggcttagccacagaagttcaaggtgaccagcag
gcgtgctttggttttgctggcacatctggatatatttctccagaagttttacataaagat
ccttatggaaaaccagtggctatgtgggcatgtggtgtcattccctatattctactggtg
gggtgtccacccttctgggatgaaaatcaacacagactctatcagcagatcaaggctgga
gcttatgattttccatcaccggaatgggatatggtgactcctaaagccaaagacctcatc
aataaaatgcttactaccaaccctgccaaatgtatcacagcctcagaggcactcaaacac
ccatggatctgccagcattctgctgtggcttccacgatgcacagacaggagactatagac
tgctttaagaaatttaatgctagaagaaaactaaagggtcccatcttgacgactatggtg
gctacaaggaatttctcagtagccaagagtttgttgaagaaaccagatggagtaaaggag
tcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacgaaagcaagag
attaccaaagccactggacaactggtcgaggctatcaacaacggagactttgaagcccac
agaaaagtctgtgacccaggccttaccgcttttgaacctgaagccctgggtaagttagtg
gaagggatggattttcaccaattctactttgaaagtgctttgccccaaagcactaaacca
atccacactattattctaaaccctcatgtacatctggtaagggatgatgctgcctgcaaa
acactgtacacacagtacatggatggcagtggaatgccaaggacaatgcaggcagaagag
actcgtgtgtggcaccgccgggatgcaaagtggcagaatgttcattttcatcgcttgtgg
tcaccagcagtacccaccaactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397956Help
Entry
100397956         CDS       T03264                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04114  Oocyte meiosis
cjc04217  Necroptosis
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05031  Amphetamine addiction
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100397956 (CAMK2D)
   04310 Wnt signaling pathway
    100397956 (CAMK2D)
   04066 HIF-1 signaling pathway
    100397956 (CAMK2D)
   04020 Calcium signaling pathway
    100397956 (CAMK2D)
   04024 cAMP signaling pathway
    100397956 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100397956 (CAMK2D)
   04217 Necroptosis
    100397956 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100397956 (CAMK2D)
   04922 Glucagon signaling pathway
    100397956 (CAMK2D)
   04912 GnRH signaling pathway
    100397956 (CAMK2D)
   04921 Oxytocin signaling pathway
    100397956 (CAMK2D)
   04916 Melanogenesis
    100397956 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    100397956 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100397956 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    100397956 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    100397956 (CAMK2D)
   04728 Dopaminergic synapse
    100397956 (CAMK2D)
   04720 Long-term potentiation
    100397956 (CAMK2D)
   04722 Neurotrophin signaling pathway
    100397956 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    100397956 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    100397956 (CAMK2D)
  09158 Development
   04360 Axon guidance
    100397956 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100397956 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397956 (CAMK2D)
   05205 Proteoglycans in cancer
    100397956 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    100397956 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100397956 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100397956 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100397956 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100397956 (CAMK2D)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100397956 (CAMK2D)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100397956 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Kdo Pkinase_fungal SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 100397956
NCBI-ProteinID: XP_002745503
Ensembl: ENSCJAG00000003480
Position
3
AA seq 597 aa AA seqDB search
MGNCDVSPHSPKPPGFSPAHPPPSTWFLPRRVCSCVRPKEGEREIHEGTGLESLEGARAQ
SGPRMASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQ
KLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHC
IQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAG
TPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSP
EWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNA
RRKLKGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIH
NPDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEP
EALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSG
MPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgggcaactgtgacgtctcgcctcattcacccaaacctccaggcttctcccccgcacat
cctcctccatccacctggtttctccctagacgggtgtgctcgtgtgtgcgaccgaaggag
ggagagcgagagatccacgaagggacaggcttggagtcgctagagggagccagggcacag
tccggaccgaggatggcttcgaccacaacctgcaccaggttcacggacgagtatcagctt
ttcgaggagcttggaaagggggcattctcagtggtgagaagatgtatgaaaattcctact
ggacaagaatatgctgccaaaattatcaacaccaaaaagctttctgctagggatcatcag
aaactggaaagagaagctagaatctgccgtcttttgaaacaccctaatattgtgcgactt
catgatagcatatcagaagagggttttcactacttggtgtttgatttagttactggaggt
gaactctttgaagacatagtggcaagggaatactacagtgaagctgatgccagtcattgc
attcagcagatcctggaggctgtgctacactgccatcagatgggcgtggtccatcgggac
ctgaagcctgagaatttgcttttagctagcaaatccaagggagcagctgtgaaattggca
gactttggcttagccatagaagttcaaggcgaccagcaggcgtggtttggttttgctggc
acacctggatatctttctccagaagttttacgtaaagatccttatggaaaaccagtggat
atgtgggcatgtggtgtcattctctatattctactggtggggtatccacccttctgggat
gaagaccaacacagactctatcagcagatcaaggctggagcttatgattttccatcaccg
gaatgggacacggtgactcctgaagccaaagacctcatcaataaaatgcttactatcaac
cctgccaaacgtatcacagcctcagaggcactcaaacacccatggatctgtcaacgttct
actgttgcttccatgatgcacagacaggaaactgtagactgcttgaagaaatttaatgct
agaagaaaactaaagggtgccatcttgacaactatgctggctacaaggaatttctcagca
gccaagagtttgttgaagaagccagatggagtaaagataaacaacaaagccaacgtggta
accagccccaaagaaaatattcctaccccggcgctggagccccaaactactgtaatccac
aaccctgatggaaacaaggagtcaactgagagttcaaatacaacaattgaggatgaagat
gtgaaagcacgaaagcaagagattatcaaagtcactgaacaactgattgaagctatcaac
aatggggactttgaagcctacacaaaaatctgtgacccaggccttactgcttttgaacct
gaagctttgggtaatttagtggaagggatggattttcaccgattctactttgaaaatgct
ttgtccaaaagcaataaaccaatccacactattattctaaaccctcatgtacatctggta
ggggatgatgccgcctgcatagcatatattaggctcactcagtacatggatggcagtgga
atgccaaagacaatgcagtcagaagagactcgtgtgtggcaccgccgggatggaaagtgg
cagaatgttcattttcatcgctcggggtcaccaacagtacccatcaagccaccctgtatt
ccaaatgggaaagaaaacttctcaggaggcacctctttgtggcaaaacatctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405903Help
Entry
100405903         CDS       T03264                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04114  Oocyte meiosis
cjc04217  Necroptosis
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05031  Amphetamine addiction
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100405903 (CAMK2G)
   04310 Wnt signaling pathway
    100405903 (CAMK2G)
   04066 HIF-1 signaling pathway
    100405903 (CAMK2G)
   04020 Calcium signaling pathway
    100405903 (CAMK2G)
   04024 cAMP signaling pathway
    100405903 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100405903 (CAMK2G)
   04217 Necroptosis
    100405903 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100405903 (CAMK2G)
   04922 Glucagon signaling pathway
    100405903 (CAMK2G)
   04912 GnRH signaling pathway
    100405903 (CAMK2G)
   04921 Oxytocin signaling pathway
    100405903 (CAMK2G)
   04916 Melanogenesis
    100405903 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    100405903 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100405903 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    100405903 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    100405903 (CAMK2G)
   04728 Dopaminergic synapse
    100405903 (CAMK2G)
   04720 Long-term potentiation
    100405903 (CAMK2G)
   04722 Neurotrophin signaling pathway
    100405903 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    100405903 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    100405903 (CAMK2G)
  09158 Development
   04360 Axon guidance
    100405903 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100405903 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405903 (CAMK2G)
   05205 Proteoglycans in cancer
    100405903 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    100405903 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    100405903 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100405903 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100405903 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100405903 (CAMK2G)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100405903 (CAMK2G)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100405903 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 100405903
NCBI-ProteinID: XP_017834468
Ensembl: ENSCJAG00000001401
Position
12
AA seq 588 aa AA seqDB search
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVXQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVH
LMPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPL
RTGNGSSVPEGRSSRDRTAPSTGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYT
KICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIA
YIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctc
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtat
gcagcaaaaattatcaataccaagaagttgtctgcccgggatcaccagaaactagaacgt
gaggctcggatatgtcgacttctgaaacatccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagcagatgccagccactgtattcatcagatt
ctggaaagtgttaaccacatccaccagcatgacatcgtccacagggaccttaagccagag
aacctgctgctggcaagcaaatgcaagggtgccgctgtcaagctggctgattttggcctc
gccattgaagtgcagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctaccctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacg
gtaactcctgaagccaagaacttgatcaaccagatgctgaccataaacccagcgaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgncaacgatccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgtttgcgcaagttcaacgcccggagaaaactg
aagggtgccatcctcacgaccatgctcgtctccagaaacttctcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctattgaacaagaagtcagatggcggtgtcaagaaaaggaagtcgagttccagcgtgcac
ctaatgccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagcccgcgccc
ttgcagacggccatggagccacaaaccactgtggtacacaacgctacagatgggatcaag
ggctccacagagagctgcaataccaccacagaagatgaggacctcaaagctgccccgctc
cgcactgggaatggcagctcggtgcctgaaggacggagctcccgggacagaacagccccc
tctacaggcatgcagccccagccttctctctgctcctcagccatgcgaaaacaggagatc
attaagatcacagaacagctgattgaagccatcaacaatggggactttgaggcctacacg
aagatttgtgatccaggcctcacttcctttgagcctgaggcccttggtaacctcgtggag
gggatggatttccataagttttactttgagaatctcctgtccaagaacagcaagcccatc
cataccaccatcctaaacccacatgtccacgtgattggggaggacgcagcatgcatcgcc
tacatccgcctcacccagtacatcgacgggcagggtcggcctcgtaccagccagtcggaa
gagacccgggtctggcaccgtcgggatggcaagtggctcaatgtccactatcactgctca
ggggcccctgccgcaccgctgcagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410352Help
Entry
100410352         CDS       T03264                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04114  Oocyte meiosis
cjc04217  Necroptosis
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04934  Cushing syndrome
cjc04971  Gastric acid secretion
cjc05031  Amphetamine addiction
cjc05152  Tuberculosis
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100410352 (CAMK2B)
   04310 Wnt signaling pathway
    100410352 (CAMK2B)
   04066 HIF-1 signaling pathway
    100410352 (CAMK2B)
   04020 Calcium signaling pathway
    100410352 (CAMK2B)
   04024 cAMP signaling pathway
    100410352 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100410352 (CAMK2B)
   04217 Necroptosis
    100410352 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100410352 (CAMK2B)
   04922 Glucagon signaling pathway
    100410352 (CAMK2B)
   04912 GnRH signaling pathway
    100410352 (CAMK2B)
   04921 Oxytocin signaling pathway
    100410352 (CAMK2B)
   04916 Melanogenesis
    100410352 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100410352 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100410352 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100410352 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100410352 (CAMK2B)
   04728 Dopaminergic synapse
    100410352 (CAMK2B)
   04720 Long-term potentiation
    100410352 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100410352 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100410352 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100410352 (CAMK2B)
  09158 Development
   04360 Axon guidance
    100410352 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100410352 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410352 (CAMK2B)
   05205 Proteoglycans in cancer
    100410352 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100410352 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100410352 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100410352 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100410352 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100410352 (CAMK2B)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100410352 (CAMK2B)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100410352 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 SnoaL_2 APH Pkinase_fungal Kdo SnoaL_4
Motif
Other DBs
NCBI-GeneID: 100410352
NCBI-ProteinID: XP_009000361
Ensembl: ENSCJAG00000008079
Position
8
AA seq 642 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNEKADGVKEPQTTVI
HNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVRRGSGAPEAEGPLPCPSPAPFSPLP
GQSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSPALLGPLPTPSPRISDILNSVRRGS
GTPEAEGPSPVGPPPCPSPSLPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKICDPG
LTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQ
YIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccacgagtat
gcagccaagatcatcaacaccaagaagctgtcggccagagatcaccagaagctggagaga
gaggctcggatctgccgccttctgaagcattccaacattgtgcgtctccatgacagcatc
tctgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcaagagagtactacagcgaggctgatgccagtcactgcatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgctcctggccagcaagtgcaaaggggctgcagtgaagctggcggacttcggcctg
gctatcgaggtgcagggggaccagcaggcatggtttgggttcgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcatatggcaagcccgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggcgcctatgacttcccatcccccgagtgggacact
gtcactcctgaagccaaaaacctcatcaaccagatgctaaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgctccacggtagcttcc
atgatgcacagacaagagacagtggagtgtctgaaaaagttcaatgccagaagaaagctc
aagggggccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccagccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacgagaaagcagatggagtcaaggagcctcaaaccaccgtcatc
cataacccagtggacgggattaaggagtcttccgacagtgccaacaccaccatagaggat
gaagatgctaaagcccccagagtccctgacatcctgagctcagtgaggaggggctcagga
gccccagaagctgaagggcccctgccctgcccatctccggctccctttagccccctgcca
ggccaatcccccaggatctctgacatcctgaactctgtgagaaggggctcaggaacccca
gaagccgagggccctctctcagcggggcccccgccctgcctgtctccagctctcctaggc
cccctgcccaccccatcccccaggatctctgacatcctgaactctgtgaggaggggctca
gggaccccagaagccgagggcccctcgccagtggggcccccgccctgcccatctccatct
ctccctggccccctgcccaccccatcccggaagcaggagatcatcaagaccacggagcag
ctcatcgaggccgtcaacaacggtgactttgaggcctacgcgaaaatctgtgacccaggg
ctgacctcgtttgagcctgaagcactgggcaacctggttgaagggatggacttccacaga
ttctacttcgagaacctgctggccaagaacagcaagccgatccacacgaccatcctgaac
ccgcacgttcatgtcatcggcgaggatgccgcctgcatcgcctacatccggctcacgcag
tacatcgacgggcagggccggccccgcaccagccagtctgaggagacccgcgtgtggcac
cgccgcgatggcaagtggcagaatgtgcacttccactgctcgggtgcgcccgtggccccg
ctgcagtga

DBGET integrated database retrieval system