KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391008Help
Entry
100391008         CDS       T03264                                 

Gene name
CDK14, PFTK1
Definition
(RefSeq) cyclin dependent kinase 14
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100391008 (CDK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100391008 (CDK14)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100391008 (CDK14)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100391008 (CDK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100391008
NCBI-ProteinID: XP_009000748
Ensembl: ENSCJAG00000014175
UniProt: B0VXE8
Position
8
AA seq 423 aa AA seqDB search
MSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPTNQVKRVHSENNACINFKTS
STGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVI
RLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPG
GLHPDNVKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSH
TYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIF
LVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKN
RLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSN
SKH
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacggaattgccagggaatggactcagtgatcaaacccctggacacaattcct
gaggataaaaaagtcagagttcagaggacacagagcacttttgacccatttgagaaacca
actaatcaagtaaagagggtgcattctgagaacaatgcttgcattaactttaagacctcc
tccactggcaaagagtcacctaaagttaggcggcactccagccccagctcgccaacaagt
cccaaatttggaaaagctgactcatatgaaaaactggaaaaattaggggaaggatcttat
gctacagtatacaaagggaaaagcaaggtaaatgggaagttggtagctctgaaggtgatc
aggctgcaagaagaagaagggacacctttcacagctatcagggaagcttctctattaaaa
ggactgaaacatgctaacatagtgctacttcatgacatcatccataccaaggagacgctg
acacttgtgtttgaatatgtgcacactgatttatgtcagtacatggacaagcaccctggg
gggctgcatccagataatgtgaagttgtttttatttcagttgctgcggggtctgtcttac
atccaccagcgttatattttgcacagagacctgaaaccacagaaccttctgatcagtgac
acgggggagttgaagctagcagatttcggtcttgcaagagcaaaatccgtccctagccac
acatactccaacgaagtggttaccctgtggtacagacctccagatgtccttctaggctca
acagaatattccacctgccttgacatgtggggagtaggttgcatctttgttgaaatgatc
caaggagttgctgcttttccaggaatgaaagacattcaggatcaacttgaacgaatattt
ctggttcttggaacgccaaatgaggacacatggcctggagttcattctttaccacatttt
aagccagaacgctttaccctgtacagctctaaaaaccttagacaagcgtggaataagctc
agctatgtgaaccatgcagaggatctggcctccaagctcctacaatgttccccaaagaac
agactatcggcacaggctgccttgagccacgagtactttagtgacctgcccccacggcta
tgggaactcaccgatatgtcttctatttttactgtcccaaatgtgagattgcaaccagaa
gctggagaaagcatgcgggcctttgggaaaaacaatagttacggcaaaagtctatcaaac
agcaaacactga

DBGET integrated database retrieval system