KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391124Help
Entry
100391124         CDS       T03264                                 

Gene name
IL22
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100391124 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100391124 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100391124 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100391124 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100391124 (IL22)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100391124 (IL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL22 IL10 IL28A
Motif
Other DBs
NCBI-GeneID: 100391124
NCBI-ProteinID: XP_009002421
Ensembl: ENSCJAG00000007195
UniProt: F6WL87
Position
9
AA seq 179 aa AA seqDB search
MTALQKSVSSFLMGSLATSYLLLLALSVQGGTAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFRGVSMSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVS
FLARLSNRLSTCHIEGDDLHIQRNVQNLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctgcagaaatctgtgagctctttccttatggggtctctggccaccagctac
ctccttctcttggccctctcggtgcagggaggaacagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggagaaactgttc
cgcggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaactttaccctt
gaagaagtgctgctccctcagtctgataggttccagccttatatgcaggaggtggtgtcc
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaatctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgttgtttatgtctctgagaaatgcctgcatttga

DBGET integrated database retrieval system