KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391322Help
Entry
100391322         CDS       T03264                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04071  Sphingolipid signaling pathway
cjc04115  p53 signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04722  Neurotrophin signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05020  Prion diseases
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100391322 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100391322 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100391322 (BAX)
   04215 Apoptosis - multiple species
    100391322 (BAX)
   04217 Necroptosis
    100391322 (BAX)
   04115 p53 signaling pathway
    100391322 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100391322 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100391322 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391322 (BAX)
   05202 Transcriptional misregulation in cancer
    100391322 (BAX)
   05203 Viral carcinogenesis
    100391322 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100391322 (BAX)
   05212 Pancreatic cancer
    100391322 (BAX)
   05225 Hepatocellular carcinoma
    100391322 (BAX)
   05226 Gastric cancer
    100391322 (BAX)
   05214 Glioma
    100391322 (BAX)
   05216 Thyroid cancer
    100391322 (BAX)
   05220 Chronic myeloid leukemia
    100391322 (BAX)
   05217 Basal cell carcinoma
    100391322 (BAX)
   05218 Melanoma
    100391322 (BAX)
   05213 Endometrial cancer
    100391322 (BAX)
   05224 Breast cancer
    100391322 (BAX)
   05222 Small cell lung cancer
    100391322 (BAX)
   05223 Non-small cell lung cancer
    100391322 (BAX)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100391322 (BAX)
   05016 Huntington disease
    100391322 (BAX)
   05020 Prion diseases
    100391322 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100391322 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100391322 (BAX)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100391322 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100391322 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100391322 (BAX)
   05162 Measles
    100391322 (BAX)
   05164 Influenza A
    100391322 (BAX)
   05161 Hepatitis B
    100391322 (BAX)
   05160 Hepatitis C
    100391322 (BAX)
   05168 Herpes simplex virus 1 infection
    100391322 (BAX)
   05163 Human cytomegalovirus infection
    100391322 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100391322 (BAX)
   05169 Epstein-Barr virus infection
    100391322 (BAX)
   05165 Human papillomavirus infection
    100391322 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100391322 (BAX)
   01524 Platinum drug resistance
    100391322 (BAX)
   01522 Endocrine resistance
    100391322 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100391322 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100391322 (BAX)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100391322 (BAX)
Transporters [BR:cjc02000]
 Other Transporters
  Pores ion channels [TC:1]
   100391322 (BAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 TetR_C_30
Motif
Other DBs
NCBI-GeneID: 100391322
NCBI-ProteinID: XP_017822885
Ensembl: ENSCJAG00000000253
Position
22
AA seq 115 aa AA seqDB search
MIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMG
WTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgattgccgctgtggatacagactccccacgagaggtcttttttcgagtggcagctgac
atgttctctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagc
aaactggtgctcaaggccctgtgtgccaaggtgcccgagctgatcagaaccatcatgggc
tggactttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgg
gatggcctcctctcctacttctttgggacccccacgtggcagacagtgaccatctttgtg
gctggagtgctcaccgcctcgcttaccatctggaagaacatgggctga

DBGET integrated database retrieval system