KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391332Help
Entry
100391332         CDS       T03264                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05215  Prostate cancer
cjc05219  Bladder cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100391332 (ERBB2)
   04012 ErbB signaling pathway
    100391332 (ERBB2)
   04066 HIF-1 signaling pathway
    100391332 (ERBB2)
   04020 Calcium signaling pathway
    100391332 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100391332 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100391332 (ERBB2)
   04520 Adherens junction
    100391332 (ERBB2)
   04530 Tight junction
    100391332 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391332 (ERBB2)
   05206 MicroRNAs in cancer
    100391332 (ERBB2)
   05205 Proteoglycans in cancer
    100391332 (ERBB2)
   05230 Central carbon metabolism in cancer
    100391332 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100391332 (ERBB2)
   05226 Gastric cancer
    100391332 (ERBB2)
   05219 Bladder cancer
    100391332 (ERBB2)
   05215 Prostate cancer
    100391332 (ERBB2)
   05213 Endometrial cancer
    100391332 (ERBB2)
   05224 Breast cancer
    100391332 (ERBB2)
   05223 Non-small cell lung cancer
    100391332 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100391332 (ERBB2)
   01524 Platinum drug resistance
    100391332 (ERBB2)
   01522 Endocrine resistance
    100391332 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100391332 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100391332 (ERBB2)
   04090 CD molecules [BR:cjc04090]
    100391332 (ERBB2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100391332 (ERBB2)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100391332 (ERBB2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100391332 (ERBB2)
CD molecules [BR:cjc04090]
 Proteins
  100391332 (ERBB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100391332
NCBI-ProteinID: XP_002806904
Ensembl: ENSCJAG00000008874
UniProt: F7CBG7
Position
5
AA seq 1255 aa AA seqDB search
MELAAWCRWGLLFALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLDNTTPVTGASPGGLRELQLRSLTEILKGGVWIQRNPQLCYQDMVLWKDIFHKNNQLA
LTLIDTNRSRACHPCSPACKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTVPLQPEQLQVFETLEEITGYLYISAWPDSLP
DLSVFQNLQVIRGRILHNGAYLLTLQGLGISWLGLRSLRELGSGLALIHHNARLCFVHTV
PWDNLFRNPHQALLHTANRPEHECVGKDLACHPLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCSGPEADQCVACAHYKDSPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLFMVLGLLLGILMKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMEDLVDA
EEYLVPQQGFFCPDPAPGAGGMAHHRHRSSSTRSGSGDLMLGLEPSEEEAPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQSLPPHDPSPLQRYSEDPTVPLPSETDGYVAPPTCSPQPEYV
NQPDVRPQPSLPQEGPLPPARPAGATLERPKTLSPGKNGVVKDVFAFGSAVENPEYLAPR
GGAAPQPHPPPAFSPAFDNLYYWDQDPSERGAPPSTFEGTPTAENPEYLGLDVPV
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcttcgccctcttgccccccggagcc
gcgggcacccaagtgtgcaccggcacggacatgaagctgcggctccctgccagtcctgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggtaacctg
gaactcacctacctgcctgccaatgccagcctctccttcctgcaggatatacaggaggtg
cagggctacgtgctcatcgcccacaaccaagtgagacaggtcccgctgcagaggctgcgg
attgtacgaggcacccagctctttgaggacaactatgccctggctgtgctagacaacgga
gaccctctggacaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaagggaggggtctggatccagcggaacccccag
ctctgctaccaggacatggttttgtggaaggacatcttccacaagaacaaccagctggct
ctcacactgatagacaccaaccgctctcgggcctgccacccctgctctccggcgtgtaag
ggctcccgctgctggggagagagttctgaggactgtcagagcctgacacgcactgtctgt
gccggtggctgtgcccgctgcaagggcccgctgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacctttgag
tccatgcccaaccctgagggccggtatacatttggcgccagctgtgtgactgcctgtccc
tacaactacctatcaacggacgtgggatcctgcacacttgtctgccccctgcacaaccaa
gaggtgacagcggaggacggaacacagcggtgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtaagggcggtcaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcctggcatttctgccggagagc
tttgatggggacccagcctccaacaccgtccccctacagccagagcagctccaagtgttt
gagactctggaagagatcacaggttacctgtacatctcagcatggccagacagcctgccc
gacctcagcgtcttccagaacctgcaagtaatccgaggacgaattctgcacaatggcgcc
tacttgctgaccctgcaaggcctgggcatcagctggctggggctgcgctcactgcgggaa
ctgggcagtggactggccctcatccaccacaatgcacgcctctgcttcgtgcacacggtg
ccctgggacaatctcttccggaacccgcaccaagccctgctccacactgccaaccggcca
gagcatgagtgtgtgggcaaggatctggcctgccacccgctgtgcgcccgagggcactgc
tggggtccggggcccacccagtgtgtcaactgcagtcagttccttaggggccaggaatgc
gtggaggaatgccgagtactgcagggtctccccagggagtatgtgaatgccagacactgt
ttgccgtgccaccctgagtgtcagccccagaatggctcagtgacctgttctggaccggag
gctgaccagtgtgtggcctgtgcccactacaaggactctcctttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacatgccagccttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgctgagcagagagccagccctctgacgtccatcatctctgcggtggtgggc
attctgctgttcatggtcttggggctgctccttgggatcctcatgaagcgacggcagcag
aagatccggaagtacacgatgcggaggctgctgcaggaaacggagctggtggagccgctg
acaccgagcggagccatgcccaaccaggcacagatgcggatcctgaaagagaccgagctg
aggaaggtgaaggtgcttggatctggagcttttggcacagtctataagggaatctggatc
cctgatggggagaacgtgaaaattccagtggccatcaaagtgttgagagaaaacacatcc
cctaaagccaacaaagaaatcttagacgaagcgtatgtgatggctggtgtgggctcccca
tatgtctcccgcctcctgggcatctgcctgacatccacagtgcaactggtgacacagctc
atgccctatggctgcctcttagaccatgtccgggaacaccgaggacgtctgggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacctggaagatgtgcgg
ctcgtacacagggacttggctgcccggaacgtgctggtcaagagtcccaatcacgtcaag
attacagacttcgggctagctcggctgctggacattgatgagacagaataccatgcagat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagttacggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttatgatgggatcccagcccgggagatccctgacctgctggagaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccaagattccgggagttggtgtctgaattctcccgaatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gatagcaccttctaccgctcactgctggaggacgatgacatggaggacctggtggatgcc
gaggagtatctggtgccccagcagggcttcttctgcccagaccctgccccaggtgctggg
ggcatggcccaccacaggcaccgcagctcatccactaggagtggcagtggggacctgatg
ctagggctggagccctctgaagaggaggcccccaggtctccactggcaccctccgaaggg
gctggctccgatgtatttgatggtgacctgggaatgggagcagccaaggggctgcaaagc
ctccccccacatgaccccagtcctctccagcggtacagtgaggaccccacagtacccctg
ccctctgagactgatggctacgttgcccccccgacctgcagcccccagcctgaatatgtg
aaccagccagatgttcggccacagccctctttgccccaagagggtcctctgcctcctgcc
cgacctgctggtgccactctggaaaggcccaagactctctccccagggaagaatggggtc
gtcaaagatgtttttgcctttgggagtgccgtggagaaccccgagtacttggcaccccgg
ggaggagctgcccctcagccccaccctcctcctgccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggggctccacccagcaccttcgaagggacc
cctacggcagagaacccagagtacctgggtcttgacgtgccagtgtga

DBGET integrated database retrieval system