KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391414Help
Entry
100391414         CDS       T03264                                 

Gene name
NSUN2
Definition
(RefSeq) NOP2/Sun RNA methyltransferase family member 2
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjc03016]
    100391414 (NSUN2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     100391414 (NSUN2)
Transfer RNA biogenesis [BR:cjc03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    100391414 (NSUN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 100391414
NCBI-ProteinID: XP_002745187
Ensembl: ENSCJAG00000008689
UniProt: F6Y709
Position
2
AA seq 775 aa AA seqDB search
MGRRSRCRRLQQQQRPESAEDRAEGGGKRGEAGWEGGYPEIVKENKLFEHYYRELKIVPE
GEWDQFMDALREPLPATLRITGYKSHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSW
YPEELAWHTNLSRKILRKSPQLEKFHQFLVSETESGNISRQEAVSMIPPLLLNVQPHHKI
LDMCAAPGSKTTQLIEMLHADMSVPFPEGFVIANDVDNKRCYLLVHQAKRLSSPCIMVVN
HDASSIPRLQMDVGGTKEILFYDRILCDVPCSGDGTMRKNIDVWKKWTTLNSLQLHGLQL
RIATRGAEQLAEGGRMVYSTCSLNPVEDEAVIASLLEKSEGALELADVSNELPGLKWMPG
ITQWKVMTKDGQWFADWDAVPHSRHTQIRPTMFPLKDPEKLQAMHLERCLRILPHHQNTG
GFFVAVLVKKSSMPWNKRQPKLQGKSADTRGSTQLSPADPTEGTPADPSKLESPSVTGTG
DTEIAHAPEDLESNGNRKDGVCGPPPSKKRKLFGFKEDPFVFIPEDDPLFPPIEKFYALD
PSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSERMKVINTGIKVWCRNNSGEEFDCA
FRLAQEGIYTLYPFINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLK
YEPDSANPDSLQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLGEKKKEGVILTNE
NAASTGQLENEVTEGQRAGETHSPDAREADSPDAGESDSPDVTAGCDLAEAHLPR
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggggcggcggtcgcggtgccggcggctccagcagcagcagcggcctgagagcgccgag
gaccgtgctgagggcggcggaaagcgcggcgaggcgggctgggaaggagggtatcccgag
atcgtcaaggagaacaagctgtttgagcactactaccgggagctcaagatcgtgcccgag
ggcgagtgggaccagttcatggacgccctcagggagcccctcccggccactttaagaatt
actggttacaaaagccatgcaaaagagattctccactgcttaaagaacaaatatttcaag
gaattggaggacctggaggtggatggtcagaaagttgaagttccacagccactgagttgg
tatcctgaagaacttgcctggcacacaaatttaagtcgaaaaattttgagaaaatcacca
cagttggaaaagtttcatcagtttctagttagcgaaacggaatccggaaatatcagtcgt
caggaagctgttagcatgatcccaccactgctgctcaacgtccagcctcatcataagatc
ttagatatgtgtgcagcacctggctcaaagaccacacagttaattgaaatgctacatgcc
gacatgagtgtcccctttccagaggggtttgttattgcgaatgatgtggacaacaagcgc
tgctacctgctcgtccatcaagccaagaggctgagcagcccctgcatcatggtggtcaac
catgacgcctccagcataccccggctccagatggatgtgggcggcacgaaggagatcctc
ttctatgatcgaattttatgtgatgtcccttgcagtggagatggcactatgagaaaaaac
attgacgtttggaaaaagtggaccactttaaatagcttgcagctacatggcttgcagctg
cggattgcgacacgcggggctgagcagctggctgaaggtggaaggatggtgtattccaca
tgttcactaaaccctgttgaggatgaagcagtcatagcatccttactcgaaaaaagtgaa
ggtgccttggagcttgccgatgtgtctaatgaactgccagggctgaagtggatgccggga
atcactcagtggaaggtaatgacaaaagatgggcagtggtttgcagactgggatgctgtt
cctcacagcagacacacccagatccgacctaccatgttccctctgaaggacccggaaaaa
ctgcaggccatgcatctagagcgatgccttaggatattaccccatcatcagaatactgga
gggttctttgtggcagtattggtgaaaaaatcttcaatgccatggaacaaacgtcaacca
aagctgcagggtaaatccgcagacaccagaggaagcacccagctgagccctgcagatccc
acagaagggacacccgcagatccctctaagctggaaagtccatcagtcacaggaactggt
gacacagaaatagctcatgcaccggaggatttagagagtaatggcaataggaaagatggc
gtgtgtggtcctcctccatcgaagaaaaggaagttattcggatttaaagaagacccgttt
gtattcattcctgaagatgacccattatttccacctatcgagaaattttatgctttggat
ccttcattcccaaggatgaatttgttaactcggacaacagaagggaagaaaaggcagctc
tacatggtttctaaggagctacggaacgtgctgctgaataacagtgagaggatgaaggtt
attaacacgggaataaaagtctggtgtcgaaataacagtggcgaagagtttgactgtgct
ttccggttggcacaggagggaatatatacattgtatccatttattaattcaagaataatt
accgtatcaatggaagacgttaagatactgttgacccaggaaaaccccttttttagaaaa
ctcagcagtgagacatacagccaagcaaaggacctagcaaagggaagcatcgtgctgaag
tatgaaccagattctgcgaatccagactctctgcagtgtcccattgtcttatgcggatgg
cggggaaaggcctccattcgaacttttgtgcccaagaatgagcggcttcattatctcagg
atgatggggctggaggtattgggagaaaagaaaaaggaaggggttatcctaacaaatgag
aatgcagccagcactggacagctggagaatgaggtgaccgagggacagagagcaggagag
acccacagtcctgatgccagagaggccgacagcccagacgccggagagtccgacagccca
gatgtgacagcaggctgtgacctggcagaggcccacctgccccggtga

DBGET integrated database retrieval system