KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391471Help
Entry
100391471         CDS       T03264                                 

Gene name
ACADM
Definition
(RefSeq) acyl-CoA dehydrogenase, C-4 to C-12 straight chain
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00410  beta-Alanine metabolism
cjc00640  Propanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc01212  Fatty acid metabolism
cjc03320  PPAR signaling pathway
Module
cjc_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
cjc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100391471 (ACADM)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100391471 (ACADM)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100391471 (ACADM)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100391471 (ACADM)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100391471 (ACADM)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     100391471 (ACADM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 100391471
NCBI-ProteinID: XP_008999752
Ensembl: ENSCJAG00000006692
Position
7
AA seq 421 aa AA seqDB search
MAAGFVRCCRVLRSISRFHWRSQHTKSALQREPGLGFSFELTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLITEELAYGCTGVQ
TAIEANSLGEMPVIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAAIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDPDPQAPANKAFTGFIVEADTPGVQIGRKELNM
GQRCSDTRGIVFEDVKVPKENVLIGEGAGFKIAMGAFDRTRPAVAAGAVGLAQRALDEAT
KYALERKTFGKLLAEHQAVSFMLAEMVMKVELARMSYQRAAWEVDSGRRNTYYACIAKAF
EGDIANQLARDAVQIFGGNGFNTEYPVENIMRDAKIYQIYEGTAQIQRVIVAREHIGKYK
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggggttcgtgcgatgctgcagggtcctgagaagtatttctcgttttcattgg
cgatcacagcatacaaaatctgctctacaacgtgaaccaggattaggatttagttttgag
ctcactgaacagcagaaagaatttcaagctactgctcgtaaatttgccagagaggaaata
atcccagttgctgccgaatatgataaaactggtgaatatccagtccccctaattagaaga
gcctgggaacttgggttaatgaatacacatattccagagaattgtggaggtcttggactt
ggaacttttgatgcttgtttaattactgaagaattggcttatggatgtacaggggttcag
actgctattgaagcaaattctttgggggaaatgcctgttattattgctggaaatgatcaa
cagaagaagaagtatttggggagaatgactgaggagccattgatgtgtgcttattgtgta
acagaacctggagcaggctctgatgtagctgctataaagaccaaagcagaaaagaaagga
gacgagtatattattaatggtcagaagatgtggataaccaatggaggaaaagctaattgg
tattttttactggcacgctctgatccagatcctcaggctcctgctaacaaagcctttact
ggattcattgtggaagcagataccccaggagtgcagattgggagaaaggaattgaacatg
ggccagagatgttcagatactagaggaattgtctttgaagatgtgaaagtgcctaaggaa
aatgttttaattggtgagggagctggtttcaaaattgcaatgggagcttttgatagaacc
agacctgcagtagctgctggtgctgttggattagcacaaagagctttggatgaagctacc
aagtatgccctggaaaggaaaacttttggaaagctccttgcagagcaccaagcagtatca
tttatgctggctgaaatggtaatgaaagttgaactagccagaatgagttaccaaagagca
gcttgggaggttgattctggtcgtcgaaatacttattatgcttgtattgcaaaggcattt
gagggagatattgcaaatcagttagctagagatgctgtgcagatatttggaggcaatgga
tttaatacagaatatcctgtagaaaacataatgagggatgccaagatttatcagatttat
gaaggtactgcacaaattcaaagagttattgtagcccgtgaacacattggcaagtataaa
aattaa

DBGET integrated database retrieval system