KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391523Help
Entry
100391523         CDS       T03264                                 

Gene name
RBX1
Definition
(RefSeq) ring-box 1
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03420  Nucleotide excision repair
cjc04066  HIF-1 signaling pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04120  Ubiquitin mediated proteolysis
cjc04141  Protein processing in endoplasmic reticulum
cjc04310  Wnt signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04710  Circadian rhythm
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100391523 (RBX1)
   04120 Ubiquitin mediated proteolysis
    100391523 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100391523 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100391523 (RBX1)
   04350 TGF-beta signaling pathway
    100391523 (RBX1)
   04066 HIF-1 signaling pathway
    100391523 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100391523 (RBX1)
   04114 Oocyte meiosis
    100391523 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100391523 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391523 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100391523 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100391523 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100391523 (RBX1)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100391523 (RBX1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     100391523 (RBX1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100391523 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     100391523 (RBX1)
   ECV complex
     100391523 (RBX1)
   Cul3 complex
     100391523 (RBX1)
   Cul4 complex
     100391523 (RBX1)
   Cul7 complex
     100391523 (RBX1)
   Cul9 complex
     100391523 (RBX1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100391523 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100391523 (RBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 100391523
NCBI-ProteinID: XP_002743847
Ensembl: ENSCJAG00000004763
UniProt: F7IAL6
Position
1
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcgtccgctacttcagaagagtgtaccgttgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccgttggacaacagagag
tgggaattccaaaaatatgggcactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395702Help
Entry
100395702         CDS       T03264                                 

Gene name
CUL1, cullin-1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04120  Ubiquitin mediated proteolysis
cjc04141  Protein processing in endoplasmic reticulum
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04710  Circadian rhythm
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100395702 (CUL1)
   04120 Ubiquitin mediated proteolysis
    100395702 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100395702 (CUL1)
   04340 Hedgehog signaling pathway
    100395702 (CUL1)
   04350 TGF-beta signaling pathway
    100395702 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100395702 (CUL1)
   04114 Oocyte meiosis
    100395702 (CUL1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100395702 (CUL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395702 (CUL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100395702 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100395702 (CUL1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     100395702 (CUL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8
Motif
Other DBs
NCBI-GeneID: 100395702
NCBI-ProteinID: XP_009001130
Ensembl: ENSCJAG00000010002
Position
8
AA seq 684 aa AA seqDB search
MKFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEG
RKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG
LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQ
RRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDG
LGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFV
AALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVV
FKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIG
VSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYAS
RHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIK
MDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQ
KQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKC
IDILIEKEYLERVDGEKDTYSYLA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttgaagaattacttgacaaatcttcttaaggatggagaagatttgatggat
gagagtgtactgaaattctacacccaacaatgggaagattatcgattttcaagcaaagtg
ctgaatggaatttgtgcctacctcaatagacattgggttcgccgtgaatgtgacgaagga
cgaaaaggaatatatgaaatctattcacttgcattggtgacttggagagactgtctcttc
aggccactgaataaacaggtaacaaatgctgttttaaagctgattgaaaaggaaagaaat
ggtgaaaccatcaatacaagattgattagtggagttgtacagtcttacgtggaattgggg
ctgaatgaagatgatgcatttgcaaagggccctacgttaacagtgtataaagaatccttt
gaatctcaatttttggctgacacagagagattttataccagagagagtactgaattcttg
cagcagaacccagttactgaatatatgaaaaaggcagaggctcgtctgcttgaggaacaa
cgaagagttcaggtttaccttcacgaaagcacacaagatgagttagcaaggaaatgtgag
caagtcctcattgaaaaacacttggaaattttccacacagaatttcagaatttattggat
gctgacaaaaatgaagatttgggacgcatgtataatcttgtatctagaatccaggatggc
ctaggagaattgaaaaaactgttggagacacacattcataatcagggtcttgcagccatt
gaaaaatgtggagaagctgctttaaatgaccccaaaatgtatgtacagacagtgcttgat
gttcataaaaaatacaatgccctggtaatgtctgcattcaacaatgacgcgggttttgtg
gctgctcttgataaggcttgtggtcgcttcataaacaacaatgcggttaccaagatggcc
cagtcatccagtaaatcccctgagttgctggctcgatactgtgactccttgttgaagaaa
agttccaagaacccagaggaggcagaactagaagacacactcaatcaagtgatggttgtc
ttcaagtacatagaggacaaagacgtgtttcagaagttctatgcgaagatgctggccaag
aggctcgtccatcagaacagtgcaagtgacgatgccgaagccagcatgatctccaagtta
aagcaagcttgtggtttcgagtatacctctaaacttcagcggatgttccaagacattggc
gtgagcaaagatctgaacgagcaattcaaaaagcacctgacaaattccgaacccctggac
ttggatttcagcattcaagtcctgagctccgggtcctggcccttccagcagtcttgtaca
ttcgccttgccatcagagctggaacgcagttaccagcgattcacagctttctacgccagc
cgccacagtggccgaaaactgacatggttatatcagttgtctaaaggagaactggtaact
aactgcttcaaaaacagatacactttgcaggcatccacattccagatggccatcctgctt
cagtacaacacggaggatgcctacaccgtgcagcagctgacggacagcacgcagattaaa
atggacattttggcgcaagtcctacagattttattaaagtcgaagttattggtcttggaa
gatgaaaatgcaaatgttgatgaggtggaattgaagccagataccttaataaaattatac
cttggttataaaaataagaaattaagggttaacatcaatgtaccaatgaaaaccgaacag
aagcaggaacaagaaaccacacacaaaaatatcgaggaagaccgcaaacttctgattcag
gcggccatcgtgagaatcatgaagatgaggaaggttctcaaacaccagcagttacttggc
gaggtcctcactcagctgtcctccaggttcaaacctcgggtccctgtgatcaagaaatgc
attgacattctaattgagaaggaatatttggagcgagttgatggtgaaaaggacacctac
agttacttggcttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398187Help
Entry
100398187         CDS       T03264                                 

Gene name
SKP1
Definition
(RefSeq) S-phase kinase associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04120  Ubiquitin mediated proteolysis
cjc04141  Protein processing in endoplasmic reticulum
cjc04310  Wnt signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04710  Circadian rhythm
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100398187 (SKP1)
   04120 Ubiquitin mediated proteolysis
    100398187 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100398187 (SKP1)
   04350 TGF-beta signaling pathway
    100398187 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100398187 (SKP1)
   04114 Oocyte meiosis
    100398187 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100398187 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398187 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100398187 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100398187 (SKP1)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398187 (SKP1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     100398187 (SKP1)
   Cul7 complex
     100398187 (SKP1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     100398187 (SKP1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100398187 (SKP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ Skp1
Motif
Other DBs
NCBI-GeneID: 100398187
NCBI-ProteinID: XP_002744631
Ensembl: ENSCJAG00000013613
UniProt: U3CKA4
Position
2
AA seq 163 aa AA seqDB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaattaaattgcaaagttctgatggagagatatttgaagttgatgtggaaatt
gccaaacaatctgtgactatcaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcctctaccaaatgttaatgcggcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaggatgatgagaacaaagaaaag
cgaacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaactcattctggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagattcgcaagaccttcaat
atcaaaaatgactttactgaagaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system