KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391536
Entry
100391536         CDS       T03264                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100391536 (ERAP1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100391536 (ERAP1)
Peptidases and inhibitors [BR:cjc01002]
 Metallo peptidases
  Family M1
   100391536 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100391536
NCBI-ProteinID: XP_008990027
Ensembl: ENSCJAG00000009832
Position
2
AA seq 941 aa
MVFPPLKWSLATMSFLLFSLLALLTVSTPSWCQSSEASPKGSNGTLFPWNKIRLPEYIIP
VHYDLLIHANLTKSTFWGTTEVEITASQPTSTIILHSHHLQISKATLRKGAGERLSEEPL
QVLEHHAQEQIALLAPEPLLPGLLYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTIAEGLIEDHFDVTV
KMSTYLVAFIISDFASVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLHITMFVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVKDYFFGKCFSAMEVDALNSSHPVS
TAVENPAQIREMFDDVSYDKGACILNMLREYLSADAFRIGIVQYLQKHSYKNTKNEDLWD
SMASICPTYGIQEMDGFCPRSQHSSSSSHWHQEGLDVKSMMNTWTLQKGFPLITITVSGR
NVHMKQEHYLKGSDGTPDTGYLWHVPLTFITSKSDTVHRFLLKTKTDVLILPEEVEWIKF
NVGMSGYYIVHYENDGWDSLTGLLKATHTALSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKGFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVRKYQPCVRRAEDYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE
GWDFLYSKYQSSLSSTEKNQIEFALCITQNKEKLQWILDESFKGDKIKTQEFPGILTLIG
RNPVGYPLAWQFLRENWNKLVQKFELGSPSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQSEKLEFL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtatttccgcccctcaaatggtcccttgcaacaatgtcatttctgcttttttcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcagtgaagcatctccaaaa
ggtagtaatgggacactatttccttggaataaaatccgacttcctgagtacatcatccca
gttcattatgatctcctgatccatgcaaacctcaccaagtcgaccttctggggaaccacg
gaagtagaaatcacagccagtcagcccaccagcaccatcattctgcatagtcaccaccta
cagatatctaaggccaccctcaggaagggagctggagagaggctgtcagaagaaccgctg
caggtcctggaacatcacgctcaggagcaaattgcgctgctggctcctgagcccctcctt
ccagggctcctgtacacggttgtcattcactatgctggcaatctttcagagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcatctagccatctccaatatgcca
ttggtgaaatctgtgactattgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgcatctgtcagcaagatg
accaaaagtggagtcaaggtttctgtatatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcagtgactcttctagaattttatgaggattatttcagcatacca
tatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtcttct
gcatcaagtaagcttcacatcacaatgtttgtggcccatgaactggctcaccagtggttt
gggaacctggtcactatggaatggtggaatgacctttggctaaatgaggggtttgccaaa
tttatggagtttgtgtctgtcagcgtgacccatcctgaactgaaagttaaagattatttc
tttggcaaatgtttcagtgcgatggaggtagatgctttaaattcctcacaccctgtgtct
acagctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgatgcatttagaattggc
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacatatggcatacaagagatggatggcttttgccctaga
agtcagcattcatcttcatcctcacactggcatcaggaaggcctggatgtgaaaagcatg
atgaacacttggacactgcagaagggtttccccctgataaccatcacagtgagcgggagg
aacgtgcacatgaagcaagagcactacctgaagggatctgacggcaccccagacactggg
tacctgtggcatgttccattgacattcatcactagcaaatcagacacggtccatcgattt
ttgttgaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtaggcatgagtggctactacatcgtacattacgagaatgacggatgggactctttg
actggccttttaaaagcaacacacacagcactcagcagtaatgaccgggcgagtctcatt
aacaatgcatttcagcttgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaagggttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
ggcttcctcataaggctgctacgggacctcattgataagcagacatggacagacgagggc
tcagtctcagagcgaatgctgcggagtcagctactcctcctcgcctgtgtgcgcaagtat
cagccgtgcgtacgcagggcagaagactatttcagaaagtggaaggaatccaatggaaac
ttgagtctgcctgtcgacgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagtcttctttgtctagtactgagaaaaaccaa
attgaatttgccctctgcataacccaaaataaggaaaagcttcaatggatactagatgaa
agctttaagggtgataaaataaaaactcaggagtttccaggcattctaacattaattggc
aggaacccagttggatacccattggcctggcaatttctgagggaaaactggaacaaactt
gtacaaaaatttgaacttggctcaccttccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aacggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaatatccgt
tggatggataagaattttgataaaatcagagtatggctgcagagtgaaaagctagaattt
ctgtaa

DBGET integrated database retrieval system