KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391592
Entry
100391592         CDS       T03264                                 
Symbol
KCNH7
Name
(RefSeq) potassium voltage-gated channel subfamily H member 7
  KO
K04910  potassium voltage-gated channel Eag-related subfamily H member 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100391592 (KCNH7)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100391592 (KCNH7)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS_3 PAS PAS_8 PAS_4 ATG16
Other DBs
NCBI-GeneID: 100391592
NCBI-ProteinID: XP_002749433
Ensembl: ENSCJAG00000005995
Position
6:55928207..56443433
AA seq 1196 aa
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDDENATSPQRVNPILPVKTVNRKFFGFKFPALRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFSVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSSESE
GGRENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSSSAQQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGAEY
QRPIIRLMRTSQPLASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYLHPIRHPSLPESSLSTVGILGLHRHVSDPGLPGK
NT seq 3591 nt   +upstreamnt  +downstreamnt
atgcctgtgcgcagggggcatgtggcaccacaaaatacatttctggggaccatcattcgg
aaatttgaagggcaaaataaaaaatttatcattgcaaatgccagagtgcagaactgtgcc
atcatctattgcaacgatgggttctgtgagatgactggtttctccaggccagatgtcatg
caaaagccatgcacctgtgactttctccatggccctgagaccaagaggcatgatattgcc
caaattgcccaggcattgctggggtcagaagaaaggaaagtggaggtcacctattatcac
aaaaatgggtccacttttatttgtaacactcacataattccagtgaaaaaccaagagggt
gtggctatgatgttcatcattaattttgaatacgtaacggatgatgaaaatgctacttct
ccacagagggtaaacccaatcttaccagtcaaaactgtaaaccggaaattttttgggttc
aagttccctgctctgagagttctcacttacagaaagcagtccttaccacaagaagacccc
gatgtggtggtcatcgactcatctaagcacagtgatgattcagtagccatgaagcacttc
aagtctcctacaaaagaaagctgcagcccctctgaagcagatgatacaaaagctttgata
cagcccagcaaatgttctcccttggtgaatatatccggacctcttgaccattcctctccc
aaaaggcaatgggaccgactctaccctgacatgctacagtcaagttcccagctgtcccat
tccagatcaagggaaagcttatgtagtatacgaagagcctcttcagttcacgatatagaa
ggattcagcgtccaccccaagaacatatttagagaccggcatgccagtgaagacaatggt
cgcaatgtcaaagggccctttaatcatatcaagtcaagcctcctgggatccacatcggat
tcaaacctcaacaaatacagcaccattaacaagattccacagctcactctgaatttttca
gatgtcaagactgagaaaaagaattcatctcctccttcttcagataaaaccattattgca
cccaaggttaaagatcgaacacacaatgtgactgagaaagtgacccaggttctctcttta
ggagcagacgtcctacccgaatacaaactgcagacaccacgcatcaacaagtttacgata
ttgcactacagccctttcaaggcagtctgggactggcttattctattgttggtcatatac
actgctatatttactccctactctgcagccttcctcctcaatgacagagaagaacagaaa
agacgagaatgtggctattcttgtagccctttgaatgtggtagacttgattgtggatatt
atgtttatcatagatattttaataaacttcagaacaacatatgtaaatcagaatgaagaa
gtggtaagtgatcccgccaaaatagcaatacactacttcaaaggctggttcctgattgac
atggttgcagcaattccttttgacttgctgatttttggatctggttctgatgagacaaca
acattaattggtcttttgaagactgctcggctacttcgtctggtgcgcgtggccaggaaa
ctggatcgatattcagaatatggcgctgctgttctaatgctcctaatgtgcatatttgcc
ctgattgctcactggctggcttgcatttggtatgcgattgggaatgtagaaaggccttat
ctgactgacaaaatcggatggttggattccttaggacaacaaattgggaaacgttacaat
gacagtgactcaagttctggaccatccattaaagacaaatacgtcacagcactttatttt
accttcagcagtttaaccagtgtaggattcgggaatgtatctcctaacacgaattcggag
aaaatcttttcaatttgtgtcatgttgattggctcactaatgtatgcaagcatttttggg
aatgtatctgcaataattcaaagactatactcgggaactgccaggtaccacatgcagatg
ctgagagtaaaagagttcattcgctttcaccaaatccccaaccctctgaggcaacgtctt
gaagaatatttccagcatgcatggacttacaccaatggcattgacatgaacatggtccta
aagggtttcccagaatgcttacaagctgacatttgtctacatctcaaccagacattgctg
caaaactgcaaagcctttcggggggcaagtaaaggttgcctcagagctttggcaatgaag
ttcaagaccacccatgcacctccaggagacaccctcgttcactgtggggatgtcctcact
gcactttatttcttatccagaggctccattgaaattctcaaagatgacattgtggtggct
attctgggaaaaaatgatatatttggagaaatggttcatctttatgccaaacctggaaag
tctaatgcagatgtaagagccctcacatactgtgacttgcataagattcagcgagaagac
ttgctagaggttttggatatgtatcctgagttttccgatcactttctaacaaacctagag
ttgactttcaacctaaggcatgagagtgcaaaggctgatctcctacgatcacagtccatg
aatgattctgaaggagacaactgtaaactacggagaaggaaactgtcatctgaaagtgaa
ggagggagagaaaacagtacaaatgatcctgaagactctgcagataccataagacattat
cagagttccaagagacactttgaagaaaaaaaaagcagatcgtcatctttcatctcctcc
attgatgatgaacaaaagccgctcttctcaggaatagtagattcttctccaggaataggg
aaagcatctgggctcgattttgaagaaacagtgcccacctcaggaagaatgcacatagat
aaaagaagtcactcttgcaaagacatcactgacatgagaagctgggaacgagaaaatgca
catccccagcctgaagactccagttcatctgcacagcagcgagctgcctggggtatctct
gaaaccgaaagtgacctcacatatggggaagtggaacaaagattagatctgcttcaggaa
caacttaacaggctggaatcccaaatgaccactgacatccagaccatcttacagttactg
cagaaacaaaccactgtggtccccccagcctacagtatggttacagcaggagcagagtat
cagagacccatcatccggctgatgagaaccagtcaaccgttagcatctatcaaaactgac
cgaagtttcagcccatcctcacaatgtcctgaatttctagaccttgaaaaatctaaactt
aaatccaaagaatccctttcaagtggggtgcatctgaatacagcttcagaagacaatttg
acttcacttttaaaacaagacagtgatctctctttagagcttcatctgcggcaaagaaaa
acgtaccttcatccaattaggcatccttctttgccagaatcatccctaagcactgtagga
atcttgggtcttcataggcatgtttctgatcctggtcttccagggaaataa

DBGET integrated database retrieval system