KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391614Help
Entry
100391614         CDS       T03264                                 

Gene name
ACVR1B
Definition
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04350  TGF-beta signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100391614 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100391614 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100391614 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100391614 (ACVR1B)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100391614 (ACVR1B)
Protein kinases [BR:cjc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100391614 (ACVR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Motif
Other DBs
NCBI-GeneID: 100391614
NCBI-ProteinID: XP_002752531
Ensembl: ENSCJAG00000017891
UniProt: U3C5A2
Position
9
AA seq 505 aa AA seqDB search
MAESAGASSFFPLVVLLLSGSGGSGPRGIQALLCACTNCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctctccggc
agcggcgggtccgggccccgggggatccaggctctgctgtgtgcgtgcaccaactgcctc
caggccaactacacgtgtgagacagatggggcctgcatggtttccattttcaacctggat
gggatggagcaccatgtgcgcacctgcatccccaaagtggagctggtccctgccgggaag
cccttctactgcctcagctcggaggacctgcgcaacacccactgctgctacactgactac
tgcaacaggatcgacttgagggtgcccagtggtcacctcaaggagcctgagcacccatcc
atgtggggcccggtggagctggtaggcatcattgccggcccggtgttcctcctgttcctc
atcatcatcattgttttccttgtcattaactatcatcagcgtgtctatcacaaccgccag
agactggacatggaagatccctcatgtgagatgtgcctctccaaagacaagacgctccag
gatcttgtctatgatctctccacctcagggtctggctcagggttacccctctttgtccag
cgcacagtggcccgaaccatcgttttacaagagattattggcaagggtcgatttggggaa
gtttggcgcggccgctggaggggtggtgatgtggctgtgaaaatattctcttctcgtgaa
gaacggtcttggttccgggaagcagagatataccagacggtcatgctgcgccatgaaaac
atccttggatttattgctgctgacaataaagataacggtacctggacacagctgtggctt
gtctctgactatcatgagcatgggtccctgtttgattatctgaaccggtacacagtgaca
atcgaggggatgattaagctggccttgtctgctgccagtgggctggcacatctgcacatg
gagatcgtgggcacccaagggaagcctggaattgctcatcgagacttaaagtcaaagaac
attctggtgaagaaaaatggcatgtgtgccatagcagacctgggcctggccgtccgtcac
gatgcagtcacggacaccatcgacattgccccgaatcagagggtggggaccaaacgatac
atggcccctgaagtacttgatgaaaccattaatatgaaacactttgactcctttaaatgt
gctgatatttatgcccttgggcttgtatattgggagattgctcgaagatgcaattctgga
ggagtccatgaagaatatcagctgccatattacgacttagtgccctctgacccttccatt
gaggaaatgcgaaaggtcgtatgtgatcagaagctgcgtcccaacatccccaactggtgg
cagagttatgaggcgctgcgggtgatggggaagatgatgcgagagtgttggtatgcgaat
ggcgctgcccgcctcacggccttgcgcatcaagaagaccctctctcagctcagcgtgcag
gaagacgtgaagatctaa

DBGET integrated database retrieval system