KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391655Help
Entry
100391655         CDS       T03264                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04973  Carbohydrate digestion and absorption
cjc05100  Bacterial invasion of epithelial cells
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100391655 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100391655 (PIK3CB)
   04015 Rap1 signaling pathway
    100391655 (PIK3CB)
   04012 ErbB signaling pathway
    100391655 (PIK3CB)
   04370 VEGF signaling pathway
    100391655 (PIK3CB)
   04630 Jak-STAT signaling pathway
    100391655 (PIK3CB)
   04668 TNF signaling pathway
    100391655 (PIK3CB)
   04066 HIF-1 signaling pathway
    100391655 (PIK3CB)
   04068 FoxO signaling pathway
    100391655 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100391655 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100391655 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100391655 (PIK3CB)
   04024 cAMP signaling pathway
    100391655 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100391655 (PIK3CB)
   04152 AMPK signaling pathway
    100391655 (PIK3CB)
   04150 mTOR signaling pathway
    100391655 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100391655 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100391655 (PIK3CB)
   04218 Cellular senescence
    100391655 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100391655 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100391655 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100391655 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100391655 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100391655 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100391655 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100391655 (PIK3CB)
   04660 T cell receptor signaling pathway
    100391655 (PIK3CB)
   04662 B cell receptor signaling pathway
    100391655 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100391655 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100391655 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100391655 (PIK3CB)
   04062 Chemokine signaling pathway
    100391655 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100391655 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100391655 (PIK3CB)
   04915 Estrogen signaling pathway
    100391655 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100391655 (PIK3CB)
   04917 Prolactin signaling pathway
    100391655 (PIK3CB)
   04926 Relaxin signaling pathway
    100391655 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100391655 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100391655 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100391655 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100391655 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100391655 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100391655 (PIK3CB)
  09158 Development
   04360 Axon guidance
    100391655 (PIK3CB)
   04380 Osteoclast differentiation
    100391655 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100391655 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100391655 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391655 (PIK3CB)
   05205 Proteoglycans in cancer
    100391655 (PIK3CB)
   05203 Viral carcinogenesis
    100391655 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100391655 (PIK3CB)
   05231 Choline metabolism in cancer
    100391655 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100391655 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100391655 (PIK3CB)
   05212 Pancreatic cancer
    100391655 (PIK3CB)
   05225 Hepatocellular carcinoma
    100391655 (PIK3CB)
   05226 Gastric cancer
    100391655 (PIK3CB)
   05214 Glioma
    100391655 (PIK3CB)
   05221 Acute myeloid leukemia
    100391655 (PIK3CB)
   05220 Chronic myeloid leukemia
    100391655 (PIK3CB)
   05218 Melanoma
    100391655 (PIK3CB)
   05211 Renal cell carcinoma
    100391655 (PIK3CB)
   05215 Prostate cancer
    100391655 (PIK3CB)
   05213 Endometrial cancer
    100391655 (PIK3CB)
   05224 Breast cancer
    100391655 (PIK3CB)
   05222 Small cell lung cancer
    100391655 (PIK3CB)
   05223 Non-small cell lung cancer
    100391655 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100391655 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100391655 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100391655 (PIK3CB)
   04931 Insulin resistance
    100391655 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100391655 (PIK3CB)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100391655 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100391655 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100391655 (PIK3CB)
   05162 Measles
    100391655 (PIK3CB)
   05164 Influenza A
    100391655 (PIK3CB)
   05161 Hepatitis B
    100391655 (PIK3CB)
   05160 Hepatitis C
    100391655 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100391655 (PIK3CB)
   05163 Human cytomegalovirus infection
    100391655 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100391655 (PIK3CB)
   05169 Epstein-Barr virus infection
    100391655 (PIK3CB)
   05165 Human papillomavirus infection
    100391655 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100391655 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    100391655 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100391655 (PIK3CB)
   01524 Platinum drug resistance
    100391655 (PIK3CB)
   01522 Endocrine resistance
    100391655 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100391655 (PIK3CB)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100391655 (PIK3CB)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100391655 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 100391655
NCBI-ProteinID: XP_002759595
Ensembl: ENSCJAG00000002252
UniProt: F7CM33
Position
17
AA seq 1070 aa AA seqDB search
MCFSFIMPPAMADILDIWAVDSQIASDGTIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDGLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENSQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
ISPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIILVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEVSGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKAKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggcaccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgatccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctccatgaatttgatggcttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgcgcaaattcagtgaggagaagatc
ctgtcacttgtgggattgtcttggatggactggctaaaacaaacatatccaccagagcat
gaaccatccatccctgaaaacttagaagataaactttatggaggaaagctcattgtagct
gttcattttgaaaactcccaggatgtgtttagctttcaagtatctcctaatatgaatcct
ataaaaataaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
attagcccctatgattatgtgctgcaagtcagcgggagagtagaatatgtttttggtgat
catccactaattcagttccagtatatccggaactgtgtaatgaacaggaccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatagaaattcatctaatcttcctcttccattaccaccaaagaaaaca
cgaattatttctcatgtttgggaaaataacaaccctttccaaattatcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagctcctgtgtaaaacagtcgtaagctctgaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatatcaatacttgtgacttaccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagcaaaaacaaagaaatcaacgaaaactatt
aatccctctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatattacac
agctggtcttcatttccagatgaacttgaagaaatgttgaatccaatgggaactgttcag
acaaatccatatactgaaaatgcaacagctttgcatattaaatttccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgaaatggatcttatttggact
ttgcgacaagactgccgagagaatttcccacagtcattgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactgcttcagatttggcctaaa
ctgcccccccgggaggccctagagcttctggatttcaactatccagaccagtatgttcga
gaatatgctgtaggctgcctgcgacagatgagtgatgaagaactttctcaatatctttta
caactggtgcaagttttaaagtatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttgctaatcggaggatagggcagtttctattttggcatcttaggtcg
gaagtgcacattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgtcgg
ggaagtgtggggcacatgaaagtactttccaagcaggttgaagccctcaataagttaaaa
actttaaatagtttaataaaactgaatgcagtgaagttaaacagagccaaagggaaggag
gccatgcacacctgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cccctgaacccatgtgttatcctctcggaactctatgttgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctggtatacaataacaaagtatttggtgaggattcagtt
ggagtgattttcaaaaatggtgatgatttacgacaggatatgttgacactccaaatgttg
cgcttgatggatttactctggaaagaagctggtttggatcttcggatgttgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaattggcttaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttactctgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcaacaaggaaaaacaggaaatacagaaaagtttggc
cggttccgtcagtgttgtgaggatgcgtatctgattttacgacggcatgggaatctcttc
atcactctctttgcattgatgttaactgcagggctccctgaactcacatcagtcaaggat
atacagtatcttaaggactctcttgcattggggaagagtgaagaagaagcactcaaacag
tttaagcaaaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392639Help
Entry
100392639         CDS       T03264                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04973  Carbohydrate digestion and absorption
cjc05100  Bacterial invasion of epithelial cells
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100392639 (PIK3R1)
   04015 Rap1 signaling pathway
    100392639 (PIK3R1)
   04012 ErbB signaling pathway
    100392639 (PIK3R1)
   04370 VEGF signaling pathway
    100392639 (PIK3R1)
   04630 Jak-STAT signaling pathway
    100392639 (PIK3R1)
   04668 TNF signaling pathway
    100392639 (PIK3R1)
   04066 HIF-1 signaling pathway
    100392639 (PIK3R1)
   04068 FoxO signaling pathway
    100392639 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    100392639 (PIK3R1)
   04072 Phospholipase D signaling pathway
    100392639 (PIK3R1)
   04071 Sphingolipid signaling pathway
    100392639 (PIK3R1)
   04024 cAMP signaling pathway
    100392639 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    100392639 (PIK3R1)
   04152 AMPK signaling pathway
    100392639 (PIK3R1)
   04150 mTOR signaling pathway
    100392639 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100392639 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    100392639 (PIK3R1)
   04218 Cellular senescence
    100392639 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100392639 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100392639 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100392639 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100392639 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    100392639 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    100392639 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    100392639 (PIK3R1)
   04660 T cell receptor signaling pathway
    100392639 (PIK3R1)
   04662 B cell receptor signaling pathway
    100392639 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    100392639 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    100392639 (PIK3R1)
   04670 Leukocyte transendothelial migration
    100392639 (PIK3R1)
   04062 Chemokine signaling pathway
    100392639 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100392639 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    100392639 (PIK3R1)
   04915 Estrogen signaling pathway
    100392639 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    100392639 (PIK3R1)
   04917 Prolactin signaling pathway
    100392639 (PIK3R1)
   04926 Relaxin signaling pathway
    100392639 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    100392639 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100392639 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100392639 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    100392639 (PIK3R1)
   04722 Neurotrophin signaling pathway
    100392639 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100392639 (PIK3R1)
  09158 Development
   04360 Axon guidance
    100392639 (PIK3R1)
   04380 Osteoclast differentiation
    100392639 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    100392639 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    100392639 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392639 (PIK3R1)
   05205 Proteoglycans in cancer
    100392639 (PIK3R1)
   05203 Viral carcinogenesis
    100392639 (PIK3R1)
   05230 Central carbon metabolism in cancer
    100392639 (PIK3R1)
   05231 Choline metabolism in cancer
    100392639 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100392639 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100392639 (PIK3R1)
   05212 Pancreatic cancer
    100392639 (PIK3R1)
   05225 Hepatocellular carcinoma
    100392639 (PIK3R1)
   05226 Gastric cancer
    100392639 (PIK3R1)
   05214 Glioma
    100392639 (PIK3R1)
   05221 Acute myeloid leukemia
    100392639 (PIK3R1)
   05220 Chronic myeloid leukemia
    100392639 (PIK3R1)
   05218 Melanoma
    100392639 (PIK3R1)
   05211 Renal cell carcinoma
    100392639 (PIK3R1)
   05215 Prostate cancer
    100392639 (PIK3R1)
   05213 Endometrial cancer
    100392639 (PIK3R1)
   05224 Breast cancer
    100392639 (PIK3R1)
   05222 Small cell lung cancer
    100392639 (PIK3R1)
   05223 Non-small cell lung cancer
    100392639 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100392639 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100392639 (PIK3R1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100392639 (PIK3R1)
   04931 Insulin resistance
    100392639 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100392639 (PIK3R1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100392639 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392639 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    100392639 (PIK3R1)
   05162 Measles
    100392639 (PIK3R1)
   05164 Influenza A
    100392639 (PIK3R1)
   05161 Hepatitis B
    100392639 (PIK3R1)
   05160 Hepatitis C
    100392639 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    100392639 (PIK3R1)
   05163 Human cytomegalovirus infection
    100392639 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100392639 (PIK3R1)
   05169 Epstein-Barr virus infection
    100392639 (PIK3R1)
   05165 Human papillomavirus infection
    100392639 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100392639 (PIK3R1)
   05142 Chagas disease (American trypanosomiasis)
    100392639 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100392639 (PIK3R1)
   01524 Platinum drug resistance
    100392639 (PIK3R1)
   01522 Endocrine resistance
    100392639 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100392639 (PIK3R1)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100392639 (PIK3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I DUF4201 Lant_dehydr_C Nucleopor_Nup85 PI_PP_I Mod_r Transcrip_act
Motif
Other DBs
NCBI-GeneID: 100392639
NCBI-ProteinID: XP_002744948
Ensembl: ENSCJAG00000016007
UniProt: U3ERL3
Position
2
AA seq 724 aa AA seqDB search
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVAHGFTDGQESRPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLTE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDAASVDLEMIDVH
ILADAFKRYLLDLPNPVIPAAVYSEMISLAQEVQSSEEYVQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSASSSDNIENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVTNNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaggaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaaggttctttagtagctcat
ggattcactgatggacaggagtccaggcctgaagaaattggctggttaaatggctataac
gaaaccacaggggaaaggggggactttccaggaacttatgtagaatatattggaaggaaa
aaaatctcgcctcccacaccaaagccccggccacctcgtcctcttcctgttgcaccaggt
tcttccaaaactgaagcagatgtggagcagcaagctttgactcttccggatcttacagag
cagtttgcccctcctgacatcgccccgcctcttcttatcaagcttgtggaagccattgaa
aagaaaggtctggaatgttcaactttatacagaacacagagctccagcaacctggcagaa
ttacgacagcttcttgattgtgatgcggcctctgtggacttggaaatgatagatgtgcac
attttggcagacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttatagtgaaatgatttctttagctcaagaagtacaaagctccgaagaatatgtt
cagctattgaagaagcttattaggtcacctagcatacctcatcagtattggcttacgctt
cagtatttgttaaaacatttcttcaagctctctcaaacgtccagcaaaaatctattgaat
gcaagagttctctctgaaattttcagccctatgcttttcagattctcagcatccagctct
gataatattgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtaaccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcaagg
gaagaagtgaatgaaaaacttcgagatacagcagatgggacctttttggtacgagatgcg
tctactaaaatgcatggcgattatactcttacactaaggaaagggggaaataacaaatta
atcaaaatatttcatcgagatggaaaatatggcttctctgacccattaaccttcaattct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaattg
gatgtgaaattgctttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaagaaaaaagt
cgggaatatgataggttatatgaagaatatacccgtacatcccaggaaatccaaatgaaa
aggacagctattgaagcatttaatgaaaccataaaaatatttgaagagcagtgccagacc
caagagcggtacagcaaagaatacatagaaaagtttaaacgtgaagggaatgagaaagaa
atacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaaattattgac
agtagaagaagattggaagaagacttgaagaagcaggcggctgagtatagagaaattgac
aaacgtatgaacagcattaaaccagaccttatccagctgagaaagacaagagaccaatac
ttgatgtggttaactcaaaaaggtgttcggcaaaagaagttaaatgagtggctgggcaat
gaaaacactgaagaccaatattcattggtggaagatgatgaagatttgccccatcatgat
gagaagacgtggaatgtcggaagcagcaacagaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctacgcctgctct
gtagtggtggatggcgaagtaaagcattgtgtcataaacaaaacagcgactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctcccttgttcagcacaacgactccctcaacgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398849Help
Entry
100398849         CDS       T03264                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04973  Carbohydrate digestion and absorption
cjc05100  Bacterial invasion of epithelial cells
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100398849 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100398849 (PIK3CD)
   04015 Rap1 signaling pathway
    100398849 (PIK3CD)
   04012 ErbB signaling pathway
    100398849 (PIK3CD)
   04370 VEGF signaling pathway
    100398849 (PIK3CD)
   04630 Jak-STAT signaling pathway
    100398849 (PIK3CD)
   04668 TNF signaling pathway
    100398849 (PIK3CD)
   04066 HIF-1 signaling pathway
    100398849 (PIK3CD)
   04068 FoxO signaling pathway
    100398849 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100398849 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100398849 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100398849 (PIK3CD)
   04024 cAMP signaling pathway
    100398849 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100398849 (PIK3CD)
   04152 AMPK signaling pathway
    100398849 (PIK3CD)
   04150 mTOR signaling pathway
    100398849 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100398849 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100398849 (PIK3CD)
   04218 Cellular senescence
    100398849 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100398849 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100398849 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100398849 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100398849 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100398849 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100398849 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100398849 (PIK3CD)
   04660 T cell receptor signaling pathway
    100398849 (PIK3CD)
   04662 B cell receptor signaling pathway
    100398849 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100398849 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100398849 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100398849 (PIK3CD)
   04062 Chemokine signaling pathway
    100398849 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100398849 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100398849 (PIK3CD)
   04915 Estrogen signaling pathway
    100398849 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100398849 (PIK3CD)
   04917 Prolactin signaling pathway
    100398849 (PIK3CD)
   04926 Relaxin signaling pathway
    100398849 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100398849 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100398849 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100398849 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100398849 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100398849 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100398849 (PIK3CD)
  09158 Development
   04360 Axon guidance
    100398849 (PIK3CD)
   04380 Osteoclast differentiation
    100398849 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100398849 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100398849 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398849 (PIK3CD)
   05205 Proteoglycans in cancer
    100398849 (PIK3CD)
   05203 Viral carcinogenesis
    100398849 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100398849 (PIK3CD)
   05231 Choline metabolism in cancer
    100398849 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100398849 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100398849 (PIK3CD)
   05212 Pancreatic cancer
    100398849 (PIK3CD)
   05225 Hepatocellular carcinoma
    100398849 (PIK3CD)
   05226 Gastric cancer
    100398849 (PIK3CD)
   05214 Glioma
    100398849 (PIK3CD)
   05221 Acute myeloid leukemia
    100398849 (PIK3CD)
   05220 Chronic myeloid leukemia
    100398849 (PIK3CD)
   05218 Melanoma
    100398849 (PIK3CD)
   05211 Renal cell carcinoma
    100398849 (PIK3CD)
   05215 Prostate cancer
    100398849 (PIK3CD)
   05213 Endometrial cancer
    100398849 (PIK3CD)
   05224 Breast cancer
    100398849 (PIK3CD)
   05222 Small cell lung cancer
    100398849 (PIK3CD)
   05223 Non-small cell lung cancer
    100398849 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100398849 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100398849 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100398849 (PIK3CD)
   04931 Insulin resistance
    100398849 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100398849 (PIK3CD)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100398849 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100398849 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100398849 (PIK3CD)
   05162 Measles
    100398849 (PIK3CD)
   05164 Influenza A
    100398849 (PIK3CD)
   05161 Hepatitis B
    100398849 (PIK3CD)
   05160 Hepatitis C
    100398849 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100398849 (PIK3CD)
   05163 Human cytomegalovirus infection
    100398849 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100398849 (PIK3CD)
   05169 Epstein-Barr virus infection
    100398849 (PIK3CD)
   05165 Human papillomavirus infection
    100398849 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100398849 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    100398849 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100398849 (PIK3CD)
   01524 Platinum drug resistance
    100398849 (PIK3CD)
   01522 Endocrine resistance
    100398849 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100398849 (PIK3CD)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100398849 (PIK3CD)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100398849 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 100398849
NCBI-ProteinID: XP_017829801
Ensembl: ENSCJAG00000000442
Position
7
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLNGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRTKMCQFCEEAAARRQQLSWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHFSSILAMRDEQSNPAPQVQKPR
SKPPPIPAKKPSSVSLWSLDQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDISISDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLHMWPSVPDEKGELLNPTGTVRSNPNSDSAAALLICLPEVAP
YPVYYPPLEKILELGRHSECVRVTEEEQLQLREILERRGCGELYEHEKDLLWKLRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLGALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QXGYLEALSHVQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSSGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagcgtt
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcgcgcaatgcc
aacctcagcaccatcaagcagctgctatggcaccgtgcccagtatgagccactcttccac
atgctcaacggccctgaggcctatgtgttcacctgcatcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcggctgtgcgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgagagggcgaccgcgtgaagaagctcatcaactcgcagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgc
accaagatgtgccagttctgtgaggaggcagctgcgcgccggcagcagctgagctgggag
gcctggctgcagtacagcttcccgctgcagctggagccctcagctcgaacctgggggcct
ggcaccctgcggctccccaaccgggccctcctggtcaatgtcaagtttgagggtagcgag
gagagcttcaccttccaggtttccaccaaggatgtgcctctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccagaagactacacg
ctgcaggtgaacggcaggcacgagtacctgtatggcagctacccgctttgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccacttctcc
tccatcctcgccatgcgagatgagcagagcaaccctgccccccaggtccagaagcctcgc
tccaagccacctcccattcctgcaaagaagccctcctctgtgtccctgtggtccctggac
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggccgggcttttccacggtaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcagagcccgtgtggaagcagcggctggagtttgacatcagc
atcagcgacctgccccgcatggcccgtctctgctttgcgctatatgccgtgattgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagactggggaacgctgcctccac
atgtggccctctgtcccagatgagaaaggggagctgctgaaccccaccggcaccgtgcgc
agtaaccccaactcagacagtgccgccgccctgctcatctgcctgcctgaggtggccccg
taccccgtgtactacccgcccctggagaagatcttggagctggggcggcacagcgagtgc
gtgcgtgtcacggaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtgt
ggggagctgtatgagcatgagaaggacctgctgtggaagctgaggcacgaagtccaggag
cgcttcccagaggcattagcccggctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctgtacctgctgtgttcctggccagaactgcccgtcctgggcgcccta
gagctgctggacttcagcttccccgattgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgacgagctattccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccatcggtg
gccctgcgctttggccttatcctggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaagctgaaggccctgaatgactttgtcaag
ctgagctctcagaagacccccaagccccagaccaaggagctgatgcacctatgcatgcgg
cagngaggctacctggaggccctctcccacgtgcagtcccctcttgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgtaccttcatggactccaagatgaagccactgtgg
atcatgtatagcaacgaggaggccggcagcagtggcagcgtgggcatcatctttaagaat
ggggacgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggatctgaggatgacaccctatggctgcctccccaccggggac
cgcaccggccttattgaggtggtcctccgctcggacaccattgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggacgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccatcgaggagttcacactctcctgtgct
ggctactgtgtggccacgtacgtgctgggcatcggcgatcgacacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccgttcatcctcacctatgactttgtccat
gtgattcagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gaaagggcttacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagatatccagtatctcaaggac
tccctggcactggggaaaacagaggaggaggcactgaagcacttccgagtgaagtttaac
gaggccctccgcgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403494Help
Entry
100403494         CDS       T03264                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04973  Carbohydrate digestion and absorption
cjc05100  Bacterial invasion of epithelial cells
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100403494 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100403494 (PIK3CA)
   04015 Rap1 signaling pathway
    100403494 (PIK3CA)
   04012 ErbB signaling pathway
    100403494 (PIK3CA)
   04370 VEGF signaling pathway
    100403494 (PIK3CA)
   04630 Jak-STAT signaling pathway
    100403494 (PIK3CA)
   04668 TNF signaling pathway
    100403494 (PIK3CA)
   04066 HIF-1 signaling pathway
    100403494 (PIK3CA)
   04068 FoxO signaling pathway
    100403494 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100403494 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100403494 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100403494 (PIK3CA)
   04024 cAMP signaling pathway
    100403494 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100403494 (PIK3CA)
   04152 AMPK signaling pathway
    100403494 (PIK3CA)
   04150 mTOR signaling pathway
    100403494 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100403494 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100403494 (PIK3CA)
   04218 Cellular senescence
    100403494 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100403494 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100403494 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100403494 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100403494 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100403494 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100403494 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100403494 (PIK3CA)
   04660 T cell receptor signaling pathway
    100403494 (PIK3CA)
   04662 B cell receptor signaling pathway
    100403494 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100403494 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100403494 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100403494 (PIK3CA)
   04062 Chemokine signaling pathway
    100403494 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100403494 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100403494 (PIK3CA)
   04915 Estrogen signaling pathway
    100403494 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100403494 (PIK3CA)
   04917 Prolactin signaling pathway
    100403494 (PIK3CA)
   04926 Relaxin signaling pathway
    100403494 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100403494 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100403494 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100403494 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100403494 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100403494 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100403494 (PIK3CA)
  09158 Development
   04360 Axon guidance
    100403494 (PIK3CA)
   04380 Osteoclast differentiation
    100403494 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100403494 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100403494 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403494 (PIK3CA)
   05205 Proteoglycans in cancer
    100403494 (PIK3CA)
   05203 Viral carcinogenesis
    100403494 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100403494 (PIK3CA)
   05231 Choline metabolism in cancer
    100403494 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100403494 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100403494 (PIK3CA)
   05212 Pancreatic cancer
    100403494 (PIK3CA)
   05225 Hepatocellular carcinoma
    100403494 (PIK3CA)
   05226 Gastric cancer
    100403494 (PIK3CA)
   05214 Glioma
    100403494 (PIK3CA)
   05221 Acute myeloid leukemia
    100403494 (PIK3CA)
   05220 Chronic myeloid leukemia
    100403494 (PIK3CA)
   05218 Melanoma
    100403494 (PIK3CA)
   05211 Renal cell carcinoma
    100403494 (PIK3CA)
   05215 Prostate cancer
    100403494 (PIK3CA)
   05213 Endometrial cancer
    100403494 (PIK3CA)
   05224 Breast cancer
    100403494 (PIK3CA)
   05222 Small cell lung cancer
    100403494 (PIK3CA)
   05223 Non-small cell lung cancer
    100403494 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100403494 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100403494 (PIK3CA)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100403494 (PIK3CA)
   04931 Insulin resistance
    100403494 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100403494 (PIK3CA)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100403494 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100403494 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100403494 (PIK3CA)
   05162 Measles
    100403494 (PIK3CA)
   05164 Influenza A
    100403494 (PIK3CA)
   05161 Hepatitis B
    100403494 (PIK3CA)
   05160 Hepatitis C
    100403494 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100403494 (PIK3CA)
   05163 Human cytomegalovirus infection
    100403494 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100403494 (PIK3CA)
   05169 Epstein-Barr virus infection
    100403494 (PIK3CA)
   05165 Human papillomavirus infection
    100403494 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100403494 (PIK3CA)
   05142 Chagas disease (American trypanosomiasis)
    100403494 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100403494 (PIK3CA)
   01524 Platinum drug resistance
    100403494 (PIK3CA)
   01522 Endocrine resistance
    100403494 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100403494 (PIK3CA)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100403494 (PIK3CA)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100403494 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC DUF4135
Motif
Other DBs
NCBI-GeneID: 100403494
NCBI-ProteinID: XP_002758143
Ensembl: ENSCJAG00000013294
UniProt: U3DZL6
Position
15
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggtatccacttgatgcccccaagaatc
ctcgtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattagtaactataaagcatgaactctttaaagaagcaagaaagtaccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattgggtttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaaatatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtacataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccgtcttattccagacgcatttccacagctacaccatatatgaatgga
gagacgtctacaaaatccctttgggttataaacagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcagagagtaccttgttccaat
cccaggtggaacgaatggctgaactatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttccgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtgtctggaaaa
atggctttgaatctttggccagtacctcatgggttagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaacgccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagacatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacaggctagctagagac
aatgaattaagggaaaatgacaaagaacagctcagagcaatttgtacacgagatcctctc
tctgaaatcactgagcaagagaaagattttctatggagccaccgccactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagtt
gcccagatgtactgcttggtaaaagactggcctccaatcaaacctgagcaggctatggaa
ctgctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattggacactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggttcggcctgctcttggagtcctattgtcgtgcatgtggaatgtatctgaag
catctgaataggcaagtcgaggcgatggaaaagctcatcaacttgactgacatcctcaag
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctatctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ctgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgcttccttacggttgtctgtcc
atcggtgactgtgtggggcttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacacactgcatcagtgg
ctcaaagacaagaacaaaggagaaatatacgatgcagccattgacctgtttacgcgttct
tgtgctggatattgtgtagctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgcc
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgcactgaactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406689Help
Entry
100406689         CDS       T03264                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04973  Carbohydrate digestion and absorption
cjc05100  Bacterial invasion of epithelial cells
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100406689 (PIK3R2)
   04015 Rap1 signaling pathway
    100406689 (PIK3R2)
   04012 ErbB signaling pathway
    100406689 (PIK3R2)
   04370 VEGF signaling pathway
    100406689 (PIK3R2)
   04630 Jak-STAT signaling pathway
    100406689 (PIK3R2)
   04668 TNF signaling pathway
    100406689 (PIK3R2)
   04066 HIF-1 signaling pathway
    100406689 (PIK3R2)
   04068 FoxO signaling pathway
    100406689 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    100406689 (PIK3R2)
   04072 Phospholipase D signaling pathway
    100406689 (PIK3R2)
   04071 Sphingolipid signaling pathway
    100406689 (PIK3R2)
   04024 cAMP signaling pathway
    100406689 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    100406689 (PIK3R2)
   04152 AMPK signaling pathway
    100406689 (PIK3R2)
   04150 mTOR signaling pathway
    100406689 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100406689 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    100406689 (PIK3R2)
   04218 Cellular senescence
    100406689 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100406689 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100406689 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100406689 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100406689 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    100406689 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    100406689 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    100406689 (PIK3R2)
   04660 T cell receptor signaling pathway
    100406689 (PIK3R2)
   04662 B cell receptor signaling pathway
    100406689 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    100406689 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    100406689 (PIK3R2)
   04670 Leukocyte transendothelial migration
    100406689 (PIK3R2)
   04062 Chemokine signaling pathway
    100406689 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100406689 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    100406689 (PIK3R2)
   04915 Estrogen signaling pathway
    100406689 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    100406689 (PIK3R2)
   04917 Prolactin signaling pathway
    100406689 (PIK3R2)
   04926 Relaxin signaling pathway
    100406689 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    100406689 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100406689 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100406689 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    100406689 (PIK3R2)
   04722 Neurotrophin signaling pathway
    100406689 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100406689 (PIK3R2)
  09158 Development
   04360 Axon guidance
    100406689 (PIK3R2)
   04380 Osteoclast differentiation
    100406689 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    100406689 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    100406689 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406689 (PIK3R2)
   05205 Proteoglycans in cancer
    100406689 (PIK3R2)
   05203 Viral carcinogenesis
    100406689 (PIK3R2)
   05230 Central carbon metabolism in cancer
    100406689 (PIK3R2)
   05231 Choline metabolism in cancer
    100406689 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100406689 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100406689 (PIK3R2)
   05212 Pancreatic cancer
    100406689 (PIK3R2)
   05225 Hepatocellular carcinoma
    100406689 (PIK3R2)
   05226 Gastric cancer
    100406689 (PIK3R2)
   05214 Glioma
    100406689 (PIK3R2)
   05221 Acute myeloid leukemia
    100406689 (PIK3R2)
   05220 Chronic myeloid leukemia
    100406689 (PIK3R2)
   05218 Melanoma
    100406689 (PIK3R2)
   05211 Renal cell carcinoma
    100406689 (PIK3R2)
   05215 Prostate cancer
    100406689 (PIK3R2)
   05213 Endometrial cancer
    100406689 (PIK3R2)
   05224 Breast cancer
    100406689 (PIK3R2)
   05222 Small cell lung cancer
    100406689 (PIK3R2)
   05223 Non-small cell lung cancer
    100406689 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100406689 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100406689 (PIK3R2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100406689 (PIK3R2)
   04931 Insulin resistance
    100406689 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100406689 (PIK3R2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100406689 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100406689 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    100406689 (PIK3R2)
   05162 Measles
    100406689 (PIK3R2)
   05164 Influenza A
    100406689 (PIK3R2)
   05161 Hepatitis B
    100406689 (PIK3R2)
   05160 Hepatitis C
    100406689 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    100406689 (PIK3R2)
   05163 Human cytomegalovirus infection
    100406689 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100406689 (PIK3R2)
   05169 Epstein-Barr virus infection
    100406689 (PIK3R2)
   05165 Human papillomavirus infection
    100406689 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100406689 (PIK3R2)
   05142 Chagas disease (American trypanosomiasis)
    100406689 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100406689 (PIK3R2)
   01524 Platinum drug resistance
    100406689 (PIK3R2)
   01522 Endocrine resistance
    100406689 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100406689 (PIK3R2)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100406689 (PIK3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 DUF4201 ATG11 Ribosomal_L22e SH3_2 Tai4
Motif
Other DBs
NCBI-GeneID: 100406689
NCBI-ProteinID: XP_002761945
Ensembl: ENSCJAG00000014073
UniProt: F6ZCI2
Position
22
AA seq 727 aa AA seqDB search
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPVPARPRDGASEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESYYRPDVPALRTDWSLSDVDQWDAAALADGIKSFLLA
LPAPLVTPEASAEARRALWEAGGPVGPALEPPMLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRLPPPSSPPPGGAPDGSEPSPDFSALLVEKLLQEHLEEQEVAPPA
LPPKPPKAKPVPAGLANGGSPLSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKI
QGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRL
LYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAI
EAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTK
LEQQLRAQASDIREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNET
EDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVV
DGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGP
GPPPAAR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccctgagggcttccagtaccgtgctctgtacccattccgccgggagcggcca
gaggacctggagctgctgcctggcgacgtgctggtggtgagccgggcggccttgcaggca
ctgggtgtggccgagggtggcgagcgctgcccacagagtgtgggctggatgcctggcctc
aatgaacgcacacggcagcgaggtgacttccctggcacctatgtcgagttcctggggcct
gtggccctggcccggcccggccctcgcccacggggcccccgcccagtgcccgccaggccc
cgtgatggggcctctgagccaggcctcacactccctgacttgcctgagcagttctcccca
cctgacgtggcgccccctcttctggtgaagcttgtagaggccattgaacggacagggctg
gacagcgaatcttactaccggccagacgtccccgcactgcgtacagactggtccctgagc
gacgtggatcagtgggacgcggcagccctggccgatggcattaagagcttcctgctggca
ctgcccgcgccgctggtgacccccgaggcctcggccgaggcgcgccgggccctgtgggag
gccgggggacccgtggggccggcgctggagcccccgatgctgccgctgcaccgcgccctc
acgctgcgcttcctgctccagcacctgggccgcgtggcccgccgcgccccggctctaggt
cctgcagtccgggccctgggcgccaccttcgggccgctgctgctgcgcctgccgccgccg
tcctcaccgccgccagggggcgcgcccgacgggagtgagcccagccctgacttctcagcg
ctgctcgtggagaagctgcttcaggaacacttggaagagcaggaggttgcgcccccagcg
ctgccacctaaaccccccaaggcaaagccggtccccgcaggcctggccaatggggggagc
ccactgtccctgcaggatgctgagtggtactggggggacatctcgagggaggaggtgaac
gagaaactccgggacactcccgatggcactttcctagtccgagatgcttctagcaagatc
cagggcgagtacacgctgaccctcaggaaaggcgggaacaataagctaatcaaggtcttc
caccgggacgggcactatggcttctcggagccactcaccttctgctccgtggtggacctc
atcaatcactaccgccacgagtccctggcccagtacaacgccaagctggacacgcggctc
ctctaccctgtgtccaaataccagcaggaccagatcgtcaaggaggacagcgtggaggcg
gtgggtgcccagctcaaggtctatcaccagcagtaccaggacaagagccgcgagtacgac
cagctttatgaggagtacacacggacctcccaggagctgcagatgaagcgtacagcaatt
gaggccttcaatgagactatcaagatcttcgaagagcagggccagactcaggagaagtgc
agcaaggagtacctggagcgcttccggcgtgagggcaacgagaaggagatgcagaggatc
ctgctgaactcagagcggctcaagtcccgcattgctgagatccacgagagccgcacgaag
ctggagcagcagctgcgggcccaggcctcggacatccgggaaatcgacaagcgcatgaac
agcctcaagcctgacctcatgcagctgcgcaagatccgagaccagtacctcgtgtggctc
acccagaaaggtgcccggcagaagaaaatcaacgagtggctggggatcaaaaatgagact
gaggaccagtacgcactgatggaggatgaggatgatcttccccaccacgaggagcgcact
tggtacgtgggcaagatcaaccgcacgcaggcggaggagatgctgagtggcaagcgggac
ggcactttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtagtggta
gatggtgacaccaagcactgcgtcatttaccgcacggccaccggcttcggcttcgcggag
ccctacaacctgtacgggtctctgaaggagctggtgctgcactaccagcacgcctcgctc
gtgcagcacaacgacgcgctcacggtcaccctggcgcacccggtgcgcgccccgggcccc
ggcccgccgcctgccgcccgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414659Help
Entry
100414659         CDS       T03264                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04926  Relaxin signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04973  Carbohydrate digestion and absorption
cjc05100  Bacterial invasion of epithelial cells
cjc05142  Chagas disease (American trypanosomiasis)
cjc05146  Amoebiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100414659 (PIK3R3)
   04015 Rap1 signaling pathway
    100414659 (PIK3R3)
   04012 ErbB signaling pathway
    100414659 (PIK3R3)
   04370 VEGF signaling pathway
    100414659 (PIK3R3)
   04630 Jak-STAT signaling pathway
    100414659 (PIK3R3)
   04668 TNF signaling pathway
    100414659 (PIK3R3)
   04066 HIF-1 signaling pathway
    100414659 (PIK3R3)
   04068 FoxO signaling pathway
    100414659 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    100414659 (PIK3R3)
   04072 Phospholipase D signaling pathway
    100414659 (PIK3R3)
   04071 Sphingolipid signaling pathway
    100414659 (PIK3R3)
   04024 cAMP signaling pathway
    100414659 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    100414659 (PIK3R3)
   04152 AMPK signaling pathway
    100414659 (PIK3R3)
   04150 mTOR signaling pathway
    100414659 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100414659 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    100414659 (PIK3R3)
   04218 Cellular senescence
    100414659 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100414659 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100414659 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100414659 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100414659 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    100414659 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    100414659 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    100414659 (PIK3R3)
   04660 T cell receptor signaling pathway
    100414659 (PIK3R3)
   04662 B cell receptor signaling pathway
    100414659 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    100414659 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    100414659 (PIK3R3)
   04670 Leukocyte transendothelial migration
    100414659 (PIK3R3)
   04062 Chemokine signaling pathway
    100414659 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100414659 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    100414659 (PIK3R3)
   04915 Estrogen signaling pathway
    100414659 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    100414659 (PIK3R3)
   04917 Prolactin signaling pathway
    100414659 (PIK3R3)
   04926 Relaxin signaling pathway
    100414659 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    100414659 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100414659 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100414659 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    100414659 (PIK3R3)
   04722 Neurotrophin signaling pathway
    100414659 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100414659 (PIK3R3)
  09158 Development
   04360 Axon guidance
    100414659 (PIK3R3)
   04380 Osteoclast differentiation
    100414659 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    100414659 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    100414659 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414659 (PIK3R3)
   05205 Proteoglycans in cancer
    100414659 (PIK3R3)
   05203 Viral carcinogenesis
    100414659 (PIK3R3)
   05230 Central carbon metabolism in cancer
    100414659 (PIK3R3)
   05231 Choline metabolism in cancer
    100414659 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100414659 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100414659 (PIK3R3)
   05212 Pancreatic cancer
    100414659 (PIK3R3)
   05225 Hepatocellular carcinoma
    100414659 (PIK3R3)
   05226 Gastric cancer
    100414659 (PIK3R3)
   05214 Glioma
    100414659 (PIK3R3)
   05221 Acute myeloid leukemia
    100414659 (PIK3R3)
   05220 Chronic myeloid leukemia
    100414659 (PIK3R3)
   05218 Melanoma
    100414659 (PIK3R3)
   05211 Renal cell carcinoma
    100414659 (PIK3R3)
   05215 Prostate cancer
    100414659 (PIK3R3)
   05213 Endometrial cancer
    100414659 (PIK3R3)
   05224 Breast cancer
    100414659 (PIK3R3)
   05222 Small cell lung cancer
    100414659 (PIK3R3)
   05223 Non-small cell lung cancer
    100414659 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100414659 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100414659 (PIK3R3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100414659 (PIK3R3)
   04931 Insulin resistance
    100414659 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100414659 (PIK3R3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100414659 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100414659 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    100414659 (PIK3R3)
   05162 Measles
    100414659 (PIK3R3)
   05164 Influenza A
    100414659 (PIK3R3)
   05161 Hepatitis B
    100414659 (PIK3R3)
   05160 Hepatitis C
    100414659 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    100414659 (PIK3R3)
   05163 Human cytomegalovirus infection
    100414659 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100414659 (PIK3R3)
   05169 Epstein-Barr virus infection
    100414659 (PIK3R3)
   05165 Human papillomavirus infection
    100414659 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100414659 (PIK3R3)
   05142 Chagas disease (American trypanosomiasis)
    100414659 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100414659 (PIK3R3)
   01524 Platinum drug resistance
    100414659 (PIK3R3)
   01522 Endocrine resistance
    100414659 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100414659 (PIK3R3)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100414659 (PIK3R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Bap31_Bap29_C Mod_r
Motif
Other DBs
NCBI-GeneID: 100414659
NCBI-ProteinID: XP_017830177
Ensembl: ENSCJAG00000021001
UniProt: F7EAE6
Position
7
AA seq 461 aa AA seqDB search
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDCSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKIQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatggaatgaaggactgttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gatatgccagatgggaccttcctggtccgagatgcctcaacaaaaatgcagggagattat
actttgactttgcggaagggaggcaataataagttaataaagatctatcaccgggatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
caccatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tcccgataccaacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctgcaagaataccactctcagtatcaggagaagagtaaagagtatgataggctatatgaa
gaatatactagaacatcccaggaaatacagatgaagaggacagcaatagaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcggagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagatacaagctttggacaaccgagaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgaaagatccgagatcaacaccttgtatggctcaatcacaaagga
gtgagacagaaacgcctgaatgcctggctgggaattaagaatgaggatgctgatgagaac
tattttattaatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgtt
gaggatattaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgctatgcttgctctgtggtggccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgctgagccctacaac
ctgtacagctctctgaaggagctggtgctccattaccagcagacatccttggttcagcac
aatgactccctcaatgtcaggcttgcctaccctgttcatgcacagatgccctctctctgc
agataa

DBGET integrated database retrieval system