KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391686Help
Entry
100391686         CDS       T03264                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00071  Fatty acid degradation
cjc01212  Fatty acid metabolism
cjc03320  PPAR signaling pathway
cjc04152  AMPK signaling pathway
cjc04714  Thermogenesis
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100391686 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100391686 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100391686 (CPT1C)
   04920 Adipocytokine signaling pathway
    100391686 (CPT1C)
   03320 PPAR signaling pathway
    100391686 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    100391686 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100391686 (CPT1C)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100391686 (CPT1C)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100391686 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 100391686
NCBI-ProteinID: XP_008986668
Ensembl: ENSCJAG00000003757
Position
22
AA seq 803 aa AA seqDB search
MAEAHQAVDFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHTMLFSYQRSLPRQPVPSVH
DTVRKYLESVRPVLSDEDFDWTAVLAQEFLRLQASLLQWHLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAIHALLLYRHRLNRQEIPPTLLMGMR
PLCSAQYEKIFNTTRIPGVQKDHIRHLHDSQHVAVFHRGRFFRVGTHSRNSLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRDTWAQVRTSLKTQAAEALEVVEGAAFFVSLDAE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPDPTLPQPQRLQWDLPDQIHSSISVALRGAKILSEN
VDCHVFPFSLFGKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTE
TVRSCTREACSFVRAMEDKEKTDPQCLALLRVAVDKHQALLKAAMSGQGVDRHLFALYIV
SRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADEHGYGVS
YIFMGDDMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRSSREEAS
RRRCGFLSHQTGASKTSVTSPEL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcgcaccaggccgtggacttccgaccctcgctgacctcggacggggccgaa
gtggaactcagtgcccctgtgctgcaggagatctacctctctggcctgcgctcctggaaa
aggcatctctcacgtttctggaatgactttctcaccggtgtgttccctgccagccccctc
agctggcttttcctcttcagtgccatccagcttgcttggttcctccagctggacccttcc
ttgggactgatggagaagatcaaagagttgctccccgactggggtgggcagcaccacggg
ctccggggggtcctggcagctgcgctgtttgcctcgtgtttgtggggagccctgatcttc
acgctgcacgtggccctgaggctgcttctgtcctaccacggctggcttcttgagccccat
ggagccatgtcctctcccaccaagacctggctggccctggtccgcatcttctccggccgc
cacactatgctcttcagttaccagcgctccctgccgcgccagccggtgccctccgtgcat
gacactgtgcgcaagtacctggagtcggtccggccggtcctctccgacgaggacttcgac
tggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcgttgctgcagtggcac
ctgcgactcaagtcctggtgggcgtccaactatgtcagcgactggtgggaggaatttgtg
tacctgcgctcccgaaacccgctgatggtgaacagcaactactacatgatggacttcctg
tatgtcacacccacgcctctgcaggcagctcgcgctggaaatgccatccatgccctcctc
ctgtaccgccaccgcctaaaccgccaggagatccccccgactttgctgatgggaatgcgt
cccttatgctctgcccagtacgagaagatcttcaacaccacgcggattccaggggtccaa
aaagaccacatccgtcacctccacgacagccagcacgtggctgtcttccaccgaggccga
ttcttccgcgtggggacccactcccgaaacagcctgctttccccgagggccctggagcag
cagtttcagcgaatcctggatgatccgtcaccggcctgcccccacgaggaacatctggcc
gctctgactgctgctcccagggacacgtgggcccaggtgcggacgtccctgaagacccag
gcggcagaggccctggaggtggtggaaggggccgctttctttgtgtcactggacgctgag
cccgcgggtctcaccagggaggacccagcggcgtcattggatgcctatgcccatgccctg
ctggccggccggggccatgaccgctggtttgacaaatccttcaccctaatcgtcttctcc
aatgggaagctggggctcagcgtggagcactcctgggccgactgccccatctcaggacac
atgtgggagttcactctggctacagaatgctttcagctgggctactcagcagacggccac
tgcaagggacacccggaccccacactaccccagccccagcggctgcaatgggatcttcca
gaccagatccactcctccatctctgtagccctgcggggagccaagatcttgtctgaaaat
gtcgactgccatgtctttccattctccctgtttggcaagagcttcatcagacgctgccac
ctctcttcagacagcttcatccagatcgccttgcagctggcccacttccgggacaggggt
caattctgcctgacttatgagtcggccatgacgcgcttgttcctggaaggccggacggag
acggtgcggtcttgcacgagggaggcctgcagctttgtgagagccatggaggacaaagag
aagacagacccccagtgcctcgccctgttgcgcgtggcagtggacaagcaccaggctctg
ctgaaggcagccatgagcgggcagggagtggaccgccacctcttcgcgctctacatcgtg
tcccgattcctccacctgcagtcgcccttcctgacccaggtccattcggagcagtggcag
ctgtccaccagccagatccctgttcagcaaatgcacctgtttgacgtccacaattacccg
gactatgtttcctctggcggtggattcgggcctgctgatgagcatggttatggtgtttct
tatatcttcatgggggatgacatgatcaccttccacatctccagcaaaaagtcaagcaca
aaaacggactcccacaggctggggcagcacattgaggatgccctgctggatgtggcctcc
ctgttccaagcagggcagcattttaagcgccggttcagaagttcaagggaggaggcttcg
aggcgcaggtgtggatttctttcccaccagactggggcctccaagacatctgtgacatcc
cctgaactctga

DBGET integrated database retrieval system