KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391709Help
Entry
100391709         CDS       T03264                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc00592  alpha-Linolenic acid metabolism
cjc01100  Metabolic pathways
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04217  Necroptosis
cjc04270  Vascular smooth muscle contraction
cjc04370  VEGF signaling pathway
cjc04611  Platelet activation
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100391709 (PLA2G4F)
   00565 Ether lipid metabolism
    100391709 (PLA2G4F)
   00590 Arachidonic acid metabolism
    100391709 (PLA2G4F)
   00591 Linoleic acid metabolism
    100391709 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    100391709 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100391709 (PLA2G4F)
   04010 MAPK signaling pathway
    100391709 (PLA2G4F)
   04370 VEGF signaling pathway
    100391709 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    100391709 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100391709 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100391709 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    100391709 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    100391709 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100391709 (PLA2G4F)
   04913 Ovarian steroidogenesis
    100391709 (PLA2G4F)
   04921 Oxytocin signaling pathway
    100391709 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100391709 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    100391709 (PLA2G4F)
   04726 Serotonergic synapse
    100391709 (PLA2G4F)
   04730 Long-term depression
    100391709 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100391709 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100391709 (PLA2G4F)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100391709 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100391709
NCBI-ProteinID: XP_017824759
Position
Un
AA seq 617 aa AA seqDB search
MLWALWPRWLAGKMLPFLGAVLVQNSKKKGPPWRHRWRETHPYYDLQVKVLRATNIRGTD
LLSKADCYMQLWLPTASPSPAQTRIVANCSDPKWNETFHYQIHGAVKNVLEFTLYDKDIV
GSDQLSQLLFDLRSLKCSQPHRHIFPLNDEDLQELQVEFILEKGXVPVSEVITNGVLVVS
SPRLKIQGMLQRDGTAPHQEFGSRQLQLAVPGVYEKPQLLPLKPPAEPGLPPIFTFHANP
VLSSRLHVELTGQLSAVQSGPKELETQTSKLGEGGILLSSLPLGWEQQHSVALGEGQEVA
LSVKVEMSSVDLDLCLGFDLCDGEQEFLDRRKEVVSKALQQVLRLSEAPDSGQVPVVAVL
GSGGGTRAISSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTFYRDPVWSQVALQGPIE
CAQVLVCSSKIGALSTEWLQYYTRELGVQECSGHSVSLIDLWDLLVEYFLYQEENPAKLS
DQQEAVHQGQNPYPIYSNVNVCTNISGEDFAEWYEFTHYEIGFPKYGAYVPTELFGSEFF
MRRLLQLQPEPRICYLQGVWDSAFAASLDEIFLKTAGSGLGFLEGYRGSVNITGEGSDSE
PLPHHLAAIELWQRREE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactctggccaaggtggcttgcaggcaagatgctgcccttcctgggggca
gtgctggttcagaatagcaagaagaagggccctccttggaggcaccgttggcgggaaacc
catccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
cttctgtccaaagccgactgctacatgcaactgtggctgcccacggcatcccccagccct
gcccagactaggatagtggccaactgcagtgaccccaagtggaatgagaccttccactac
cagatccatggcgctgtgaagaatgtcctggagttcaccctctatgacaaggacatcgtg
ggcagtgaccagctctcccagctcctgtttgacctgaggagcctcaagtgcagtcaaccc
cacagacacatcttcccactcaacgacgaggatttacaagagctgcaggtggaattcatt
ctggagaaggggtgagtacctgtgtctgaagtcatcaccaatggggttctagtggtgagc
tcaccccgtctgaaaatccagggcatgctccagcgagatgggacagccccacatcaagag
ttcggctctaggcagctccagctggcagtgcctggggtctatgagaagccacagctcttg
cctctgaagcctcctgcagagccaggcctcccacccatcttcaccttccacgcgaaccca
gtgctgagctctaggctgcacgtggagctgacggggcagctctcggctgtgcagagtggc
cccaaagagctggagactcaaaccagcaagctgggtgagggaggcatcctgctctcctct
ctgcccctaggctgggagcaacagcattctgtggccctgggggagggccaggaagtggct
ctgagtgtgaaggtggaaatgagctccgtggacctggacctatgccttggctttgacctc
tgtgatggggagcaggagtttctggacaggaggaaggaggtcgtgtccaaggccctgcag
caggtgctgcgattgagtgaggctccggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacgcgagccatttcttctctgtatggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggtgtctctggatccacctggtgc
atctccacattctacagggacccagtctggtcccaggtggccttgcagggccccattgag
tgtgcccaggtcctcgtctgcagcagtaagataggagctttgtccacagagtggctacag
tactacactcgggaacttggggtccaggaatgcagtggccacagtgtgtctctcatcgac
ctctgggaccttctcgtggagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccaccagggtcagaacccttatcccatttactccaatgtcaac
gtctgcaccaacatcagtggggaagactttgcagagtggtatgagttcacccactatgag
atcggcttccccaagtatggggcgtatgttcccaccgagctcttcggctcagagttcttc
atgagacgattgctgcagctccaacccgagccccggatctgctacctgcaaggtgtgtgg
gatagcgcctttgctgccagcctggatgagatcttcctaaagactgctggctcaggtctc
ggcttcctggaggggtacagaggcagtgtgaatatcacaggtgagggtagcgactctgaa
cccctcccacaccaccttgcagcaatagagctttggcagagacgtgaagaatga

DBGET integrated database retrieval system