KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391709Help
Entry
100391709         CDS       T03264                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc00592  alpha-Linolenic acid metabolism
cjc01100  Metabolic pathways
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04217  Necroptosis
cjc04270  Vascular smooth muscle contraction
cjc04370  VEGF signaling pathway
cjc04611  Platelet activation
cjc04664  Fc epsilon RI signaling pathway
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100391709 (PLA2G4F)
   00565 Ether lipid metabolism
    100391709 (PLA2G4F)
   00590 Arachidonic acid metabolism
    100391709 (PLA2G4F)
   00591 Linoleic acid metabolism
    100391709 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    100391709 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100391709 (PLA2G4F)
   04010 MAPK signaling pathway
    100391709 (PLA2G4F)
   04370 VEGF signaling pathway
    100391709 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    100391709 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100391709 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100391709 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    100391709 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100391709 (PLA2G4F)
   04913 Ovarian steroidogenesis
    100391709 (PLA2G4F)
   04921 Oxytocin signaling pathway
    100391709 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100391709 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    100391709 (PLA2G4F)
   04726 Serotonergic synapse
    100391709 (PLA2G4F)
   04730 Long-term depression
    100391709 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100391709 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100391709 (PLA2G4F)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100391709 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100391709
NCBI-ProteinID: XP_017824759
Position
Un
AA seq 617 aa AA seqDB search
MLWALWPRWLAGKMLPFLGAVLVQNSKKKGPPWRHRWRETHPYYDLQVKVLRATNIRGTD
LLSKADCYMQLWLPTASPSPAQTRIVANCSDPKWNETFHYQIHGAVKNVLEFTLYDKDIV
GSDQLSQLLFDLRSLKCSQPHRHIFPLNDEDLQELQVEFILEKGXVPVSEVITNGVLVVS
SPRLKIQGMLQRDGTAPHQEFGSRQLQLAVPGVYEKPQLLPLKPPAEPGLPPIFTFHANP
VLSSRLHVELTGQLSAVQSGPKELETQTSKLGEGGILLSSLPLGWEQQHSVALGEGQEVA
LSVKVEMSSVDLDLCLGFDLCDGEQEFLDRRKEVVSKALQQVLRLSEAPDSGQVPVVAVL
GSGGGTRAISSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTFYRDPVWSQVALQGPIE
CAQVLVCSSKIGALSTEWLQYYTRELGVQECSGHSVSLIDLWDLLVEYFLYQEENPAKLS
DQQEAVHQGQNPYPIYSNVNVCTNISGEDFAEWYEFTHYEIGFPKYGAYVPTELFGSEFF
MRRLLQLQPEPRICYLQGVWDSAFAASLDEIFLKTAGSGLGFLEGYRGSVNITGEGSDSE
PLPHHLAAIELWQRREE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactctggccaaggtggcttgcaggcaagatgctgcccttcctgggggca
gtgctggttcagaatagcaagaagaagggccctccttggaggcaccgttggcgggaaacc
catccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
cttctgtccaaagccgactgctacatgcaactgtggctgcccacggcatcccccagccct
gcccagactaggatagtggccaactgcagtgaccccaagtggaatgagaccttccactac
cagatccatggcgctgtgaagaatgtcctggagttcaccctctatgacaaggacatcgtg
ggcagtgaccagctctcccagctcctgtttgacctgaggagcctcaagtgcagtcaaccc
cacagacacatcttcccactcaacgacgaggatttacaagagctgcaggtggaattcatt
ctggagaaggggtgagtacctgtgtctgaagtcatcaccaatggggttctagtggtgagc
tcaccccgtctgaaaatccagggcatgctccagcgagatgggacagccccacatcaagag
ttcggctctaggcagctccagctggcagtgcctggggtctatgagaagccacagctcttg
cctctgaagcctcctgcagagccaggcctcccacccatcttcaccttccacgcgaaccca
gtgctgagctctaggctgcacgtggagctgacggggcagctctcggctgtgcagagtggc
cccaaagagctggagactcaaaccagcaagctgggtgagggaggcatcctgctctcctct
ctgcccctaggctgggagcaacagcattctgtggccctgggggagggccaggaagtggct
ctgagtgtgaaggtggaaatgagctccgtggacctggacctatgccttggctttgacctc
tgtgatggggagcaggagtttctggacaggaggaaggaggtcgtgtccaaggccctgcag
caggtgctgcgattgagtgaggctccggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacgcgagccatttcttctctgtatggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggtgtctctggatccacctggtgc
atctccacattctacagggacccagtctggtcccaggtggccttgcagggccccattgag
tgtgcccaggtcctcgtctgcagcagtaagataggagctttgtccacagagtggctacag
tactacactcgggaacttggggtccaggaatgcagtggccacagtgtgtctctcatcgac
ctctgggaccttctcgtggagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccaccagggtcagaacccttatcccatttactccaatgtcaac
gtctgcaccaacatcagtggggaagactttgcagagtggtatgagttcacccactatgag
atcggcttccccaagtatggggcgtatgttcccaccgagctcttcggctcagagttcttc
atgagacgattgctgcagctccaacccgagccccggatctgctacctgcaaggtgtgtgg
gatagcgcctttgctgccagcctggatgagatcttcctaaagactgctggctcaggtctc
ggcttcctggaggggtacagaggcagtgtgaatatcacaggtgagggtagcgactctgaa
cccctcccacaccaccttgcagcaatagagctttggcagagacgtgaagaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400789Help
Entry
100400789         CDS       T03264                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc00592  alpha-Linolenic acid metabolism
cjc01100  Metabolic pathways
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04217  Necroptosis
cjc04270  Vascular smooth muscle contraction
cjc04370  VEGF signaling pathway
cjc04611  Platelet activation
cjc04664  Fc epsilon RI signaling pathway
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100400789 (PLA2G4D)
   00565 Ether lipid metabolism
    100400789 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100400789 (PLA2G4D)
   00591 Linoleic acid metabolism
    100400789 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100400789 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100400789 (PLA2G4D)
   04010 MAPK signaling pathway
    100400789 (PLA2G4D)
   04370 VEGF signaling pathway
    100400789 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100400789 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100400789 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100400789 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100400789 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100400789 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100400789 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100400789 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100400789 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100400789 (PLA2G4D)
   04726 Serotonergic synapse
    100400789 (PLA2G4D)
   04730 Long-term depression
    100400789 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100400789 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100400789 (PLA2G4D)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100400789 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 100400789
NCBI-ProteinID: XP_003733982
Ensembl: ENSCJAG00000020613
Position
10
AA seq 823 aa AA seqDB search
MESLSPGGLPGHPHQGEASACWQLTVRVLEARNLRRADLLSEADPYVTLQLSTAPGMKFK
TKTLTDSSHPVWNEAFSFLIQNQVKNVLELIIYDEDSVTEDDICFKVCYDISEVLPGKLL
RKTFSQSSQGEEELDVEFLMEETSNRPENLITNKVLVARELCCLDVHLDSTGSTAVVAGE
TETCLHLILAKRPRSDQGETCLSGLQSRYSVRICXMNEXMSEXMIFSFQSSTSNGWNGDN
STEHLTVPLRPLTIGKEVTTDVPAPHAPGVRLQLKAESCPKELAMHLSFNLCAEEQAFLS
RRKQVVAKALKQALQLDGDLQEDEVPVVGIMTTGGGARAMTSLYGHLLALQKLGLLDCVT
YFSGVSGSTWTMAHLYGDPEWSQRDLEGPIRHAREHLTKSKLEVFSPERLVSYRRELELK
AEQGHPTTFVDLWALVLESMLHGQVIDQKLSGQRAALERGQNPLPLYLSLNVKENNLETL
DFKEWVEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRTPEPRICFLEAIWSNIFSLNL
LDAWYDLTSSGEAWTRHIKDKTRSLEKEPPTSSGTSSWLGASWLQPGTALARAFKGFLTG
RPLHQRSSNFLQGLQLHQNYCNQRDFSTWADCQLDSTPSQLTPQEPQLCLVDACYFINTS
CPSMFRPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHL
FSDPACPEAPILLHFPLVNASFKDHSAPGVQRSPAELQAGQVDLTGATSPYALFNMTYKE
EDFERLLQLSHYNVRTSHGAILQALRTALKHRAREAKPSGAQT
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggactacctggccaccctcaccagggggaggcctctgcc
tgctggcagctcaccgtgagggtcctggaggcgcggaacctacgccgggccgacctgctg
agcgaggctgacccttacgtgaccctacagctgtccaccgcgcctggaatgaagtttaag
accaagacgctcacagactccagccatcctgtgtggaatgaggccttcagcttccttatc
caaaatcaggtcaagaatgttctggagcttatcatctatgatgaagactcagtcacggag
gatgacatctgcttcaaggtttgctatgacatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagttcccagggagaggaggagctggacgtggagttcctgatg
gaagaaacgtcgaatcgcccagaaaacctcatcaccaacaaagtccttgtggcccgagag
ctgtgctgcctggatgtgcacctggacagcacagggagcaccgctgtggttgcaggtgag
accgagacatgtctacacttgatcttagccaaaaggccgagaagcgatcagggagagaca
tgtctgtcgggattacagtctagatactcagtaaggatttgttgaatgaatgaatgaatg
agtgagtgaatgatattttccttccagagctccacaagcaatggctggaatggagacaac
tcaactgaacacctcactgtgcccctgaggcccttgaccattgggaaggaggtgaccacg
gatgttcctgctccacatgccccaggagtgaggctgcagctcaaggcagagagctgcccc
aaggagctagccatgcacctgagcttcaatctgtgtgcagaggagcaggccttcctgagc
aggaggaaacaggtggtggccaaagccctgaagcaggccctgcagctggacggagacctg
caggaggatgaggtacccgttgtgggcatcatgaccacaggaggaggtgcccgggccatg
acctcactctatggccacctgttggccctgcagaagctgggcctcctggactgtgtgacc
tacttcagcggcgtctctggctctacgtggacaatggcccacctgtacggggaccctgag
tggtcacagagggacctggagggacctatcagacatgcccgggagcacctgaccaagagc
aagctggaggtcttttccccagagcgcctggtgagctaccgcagggagctggagctgaag
gctgagcagggtcaccccaccacctttgtggacctgtgggcgctggtgctggagtccatg
ctgcatggccaggtgattgatcagaagctgtcaggacagagagctgccctagaacggggt
cagaaccctctacccctctacttgagcctcaatgtcaaagagaacaatctggagacactg
gacttcaaggagtgggttgagttctccccctatgaggtcgggttcctgaagtacggagcc
ttcgtccctcctgagctcttcggctccgagttcttcatgggacggctgatgaggaggacc
cctgagccccggatctgctttctggaagccatctggagcaacattttctccctgaacctg
ctggacgcctggtatgacctcaccagctctggggaggcctggacacggcacatcaaggac
aagaccaggagcttagagaaggagccccccacctcctcagggacctcctcgtggctgggg
gcctcatggctgcagccaggaacggcgctggccagggcgtttaaaggcttcctgacgggc
aggcccctccaccagcgcagctccaacttcctacagggcctccagctgcaccagaactac
tgcaaccaaagggacttctccacctgggcagactgccagcttgactccacacccagccag
ctgaccccccaggagcctcagctctgcctggtggacgcttgctattttatcaacaccagc
tgcccctccatgttccggccgggccgcaggctagacctcatcctctccttcgactactcc
ctatctgcgccctttgaggcactgcagcagacggagctgtactgccgggcccggggactg
cccttcccccgggtggaacccagccctcaggaccaacaccagccaagggagtgccacctg
ttctcagaccctgcctgcccagaggcccccatcctgctgcacttcccactggtcaatgcc
tccttcaaggaccactcagcccctggtgtccagcgcagtcccgctgagctccaggctggc
caagtagatctcaccggggccacctccccctacgccctgttcaacatgacctacaaggag
gaagacttcgagcgcctcctgcagctcagccactacaatgtgcggaccagccacggtgcc
atcctgcaggccctgaggactgcgctgaagcaccgggcccgagaggcaaagccttcaggg
gcacagacctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401154Help
Entry
100401154         CDS       T03264                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc00592  alpha-Linolenic acid metabolism
cjc01100  Metabolic pathways
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04217  Necroptosis
cjc04270  Vascular smooth muscle contraction
cjc04370  VEGF signaling pathway
cjc04611  Platelet activation
cjc04664  Fc epsilon RI signaling pathway
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100401154 (PLA2G4E)
   00565 Ether lipid metabolism
    100401154 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100401154 (PLA2G4E)
   00591 Linoleic acid metabolism
    100401154 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100401154 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100401154 (PLA2G4E)
   04010 MAPK signaling pathway
    100401154 (PLA2G4E)
   04370 VEGF signaling pathway
    100401154 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100401154 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100401154 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100401154 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100401154 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100401154 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100401154 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100401154 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100401154 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100401154 (PLA2G4E)
   04726 Serotonergic synapse
    100401154 (PLA2G4E)
   04730 Long-term depression
    100401154 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100401154 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100401154 (PLA2G4E)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100401154 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100401154
NCBI-ProteinID: XP_002807244
Ensembl: ENSCJAG00000020620
UniProt: F7I9C0
Position
10
AA seq 863 aa AA seqDB search
MSLQSSEGCPGLGTHVFVLQSPQKDEEGSRSRRNFSEVKDTQDLKTPNLPPFHPMAPWGS
QDRLSPCHLLTVRVIRMKNVRQADTLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSQVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLITNGVLVSRQVSCLEVHAQCRRRRKREKTKDLLVMVSESFENTQ
LVRPCLDPCSPTSACFHYPKYFQSRVHVEVPKSHWSCGLCCCGSRKNSLISQPLDYLSDG
QGMTLPVGENYELHVKSTPCPETLDVRLGFSLCSEELEFLRKRKVVVAKALKQVLQLEED
LQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMATLYRDP
DWSSKNLEPAIFEARRHVVKDKLPYLFPDQLCKFQEELRQRSQEGYRVTFTDFWGLLIEA
CLGYERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGLQKYGA
FIPSELFGSEFFMGRLMKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFHRWTRE
KVRDIEDEPILPEIPKCDANILETTVVIPGSWLSNTFREILTYRSFGSEFHNFLSGLQLH
TNYLQNGQFSMWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKVDLIIHL
NYCAGSQTKPLKQTCEYCSVQNIPFPEFELPDDNEDLKECYLLENPQEPDAPIVTFFPLV
NDTFQKYKAPGVERSPQELEHGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYNILNNK
DTLLQALRLAVEKKKGLKGRCPS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccagtcctcggaaggctgtcctggcctgggaactcatgtgtttgtcctacag
agcccacaaaaggatgaagaaggcagcaggtcaagaagaaatttcagcgaggtcaaggat
acacaggacctgaaaactcccaatctcccacctttccatcccatggccccttggggctct
caggacaggctgtctccatgccatctgttgacagtgcgggtcatccggatgaaaaatgtc
cggcaggctgatacgctgagccagacagactgttttgtgagcctctggctgcccactgcc
tctcagaagaagctcaggactaggaccatctccaactgcccaaacccagagtggaatgaa
agcttcaacttccagatccagagccaagtgaagaacgtgctagagttgagtgtgtgtgat
gaagacacagtgacaccagatgaccatctcttgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccacagggcatggaagagctg
gaggtggaattcctgctggaggagagcccctctccacctgagaccctcatcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacagtgcaggaggaggagg
aagagggagaaaacaaaggatctcctggtgatggtgagcgagtcctttgagaacacccag
ctcgtccggccctgcttggacccctgcagcccaacctctgcctgcttccactaccccaag
tacttccagtcccgggtgcatgtggaagtgcccaagagtcactggagctgtgggctttgc
tgctgcggctctcgcaagaatagcctcatcagccagcccctcgactacctttcggatggt
caggggatgaccctgccggtgggtgagaattatgaattacacgtgaagtctacaccctgc
cctgagacactagatgtgcggctgggcttcagcctgtgctcagaagagctggagtttctg
cggaagcggaaggtggtggtggccaaggccctgaagcaggtgctgcagctggaggaggac
ctgcaggaggatgaggtgccactgatagccatcatggccactgggggtggaacaagatcc
atgacctccatgtatggccacctgctggggctgcagaagctgaacctcctggactgtgcc
agctacatcactggcctgtcgggggcaacctggaccatggctaccttgtaccgtgatcct
gactggtcctccaaaaacctggagcctgctatcttcgaggcccggagacacgtggtaaag
gacaagctaccctacctgtttccagaccagctctgcaaattccaggaggagctacggcag
cgcagccaggaaggctacagggtcaccttcaccgacttctggggcctgttgatagaggcc
tgcctggggtacgagagaaatgaatgcaaactgtcagatcagcgtgctgctttgagctgc
ggccagaaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccag
gacttcagagagtggttcgagttctccccctatgaggtgggcctgcagaagtatggggcc
ttcatcccctctgagctctttggctccgagttcttcatggggcggctgatgaagaggatc
ccagagtctcgaatctgctacatgctaggcttgtggagcagcatcttctccctgaacctg
ctggatgcctggaacctgtcacacacctcagaggagtttttccacagatggacaagggag
aaagtgcgcgacatcgaagacgagccgatcctgcctgaaatccccaaatgtgatgctaac
atcctggagaccaccgtagtaatcccggggtcatggctctccaatactttccgagaaatc
ctcacctaccggtcctttgggtccgagtttcacaacttcctgtccgggctgcagctgcac
accaactacctccagaatggccagttctccatgtggaaagacacggtgctggatggtttc
ccgaaccagctgaccgagtctgcgaaccacctgtgcctgctggacacagcgttctttgtc
aactccagctacccgcccctccttaggccagagcgaaaagtcgacctcatcatccacctc
aactactgtgccggatcccagacaaagcccctgaaacaaacgtgtgagtactgcagcgtg
cagaacatccccttccctgaattcgaactgccagatgataatgaagacctcaaggaatgc
tacctgctggagaacccccaggagcccgatgcccccatcgtgactttcttcccactcgtc
aatgacactttccaaaaatacaaggcaccaggtgtagagcgaagcccccaggagctggag
cacggccaggtggatatttatggtcccaaaactccctatgccaccaaggagctgacgtac
acggaggccaccttcgacaagctggtgaaactctctgagtacaacatcctgaataataag
gacacactcctccaggccctacggctcgcggtggagaagaagaaggggctgaagggccgg
tgtccctcctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402439Help
Entry
100402439         CDS       T03264                                 

Gene name
PLA2G4A
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc00592  alpha-Linolenic acid metabolism
cjc01100  Metabolic pathways
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04217  Necroptosis
cjc04270  Vascular smooth muscle contraction
cjc04370  VEGF signaling pathway
cjc04611  Platelet activation
cjc04664  Fc epsilon RI signaling pathway
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100402439 (PLA2G4A)
   00565 Ether lipid metabolism
    100402439 (PLA2G4A)
   00590 Arachidonic acid metabolism
    100402439 (PLA2G4A)
   00591 Linoleic acid metabolism
    100402439 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    100402439 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100402439 (PLA2G4A)
   04010 MAPK signaling pathway
    100402439 (PLA2G4A)
   04370 VEGF signaling pathway
    100402439 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    100402439 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100402439 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100402439 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    100402439 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100402439 (PLA2G4A)
   04913 Ovarian steroidogenesis
    100402439 (PLA2G4A)
   04921 Oxytocin signaling pathway
    100402439 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100402439 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    100402439 (PLA2G4A)
   04726 Serotonergic synapse
    100402439 (PLA2G4A)
   04730 Long-term depression
    100402439 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100402439 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100402439 (PLA2G4A)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100402439 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100402439
NCBI-ProteinID: XP_002760330
Ensembl: ENSCJAG00000006080
UniProt: F7IDG2
Position
18
AA seq 749 aa AA seqDB search
MSFIDPYQHIIVEHQYSHKLTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPVSSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSCPDLRFSMALCDQEKTFRQQRKENIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVSAAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGRDYHSDSQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMMESIDYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccagtattcccacaagctt
acggtagtggtgttacgtgcgaccaaagtgacaaagggggcctttggtgacatgcttgat
actccagatccctatgtggaactttttatctctacaacccctgacagcaggaagagaaca
agacacttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagattacgttaatggatgccaattatgtcatggatgaa
actctagggacagcaacatttcctgtatcttctatgaaggtgggagagaagaaggaagtt
ccttttattttcaaccaagtcactgaaatgattctagaaatgtctcttgaagtttgctca
tgcccagacctacgatttagtatggctctgtgtgatcaggagaagactttcagacaacag
aggaaagaaaacataagagaaagcatgaagaaactgttgggtccaaagaatagtgaagga
ttgcattctgcacgtgatgtgcctgtggtagccatattgggttcaggtgggggtttccga
gccatggtgggattctctggtgtgatgaaggcattgtacgaatcaggaattctggattgt
gctacctacgttgctggtctgtctggctccacatggtacatgtcaaccttgtattctcac
cccgattttccagagaaagggccagaggagattaatgaagaactaatgaaaaatgttagc
cacaacccccttttacttctcacaccacagaaagttaaaagatacgttgagtctttatgg
aagaagaaaagctctggacagcctgtcacctttactgatatctttgggatgctaatagga
gaaacactaattcataataggatgaatactaccctgagtagtttgaaggaaaaagtcagt
gctgcacagtgccctttacctcttttcacgtgtcttcatgtcaaacccgacgtttcagag
ctgatgtttgcagattgggttgaatttagtccatacgaaattggcatggctaaatatggt
acttttatggctcccgacttatttggaagcaaattttttatgggaacagttgttaagaag
tatgaagaaaacccgttgcatttcttaatgggtgtctggggcagtgcattttccatattg
ttcaacagagttttgggtgtttctggttcgcagagtagaggctccacaatggaggaagaa
ttagaaaatattacaacaaagcatattgtgagtaatgatagctcggatagtgatgatgaa
tcacacgaacccaaaggcactgaaaatgaagatgctggaagggactatcacagtgatagt
caagcaagttggattcatcgtatgataatggccttggtgagcgattcagctttgttcaat
accagagaaggacgtgctgggaaggtgcacaacttcatgctgggcttgaatctcaataca
tcttatccactgtctcctttgagtgactttgccacacaggattcctttgatgatgatgaa
ctggatgcagctgtcgcagatcccgatgaatttgagcgaatatatgagcccctggatgtc
aaaagtaaaaagattcacgtagtggacagtgggctcacatttaacctgccgtatcccttg
atactgagacctcagagaggggttgatctcattatctcctttgatttttcggcaaggcca
agtgactccagccctccgttcaaggaacttcttcttgcagaaaagtgggctaaaatgaac
aagctcccctttccaaagatcgatccttatgtgtttgatcgggaagggctaaaggagtgc
tatgtctttaaacccaagaatcctgacatggagaaagattgtccaaccatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggcgttccaagggaaactgag
gaagagaaagaaattgctgactttgatatttttgatgacccagaatcaccattttcaacc
ttcaattttcaatatccaaatcaagcgttcaaaagactacatgatctcatgcacttcaat
accctgaacaacattgatgtcataaaggaagccatgatggaaagcattgactacagaaga
cagaatccatctcgttgctctgtttccctcagtaatgttgaggcaagaagatttttcaac
aaggagtttctaagtaaacccaaagcatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108590272Help
Entry
108590272         CDS       T03264                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc00590  Arachidonic acid metabolism
cjc00591  Linoleic acid metabolism
cjc00592  alpha-Linolenic acid metabolism
cjc01100  Metabolic pathways
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04217  Necroptosis
cjc04270  Vascular smooth muscle contraction
cjc04370  VEGF signaling pathway
cjc04611  Platelet activation
cjc04664  Fc epsilon RI signaling pathway
cjc04724  Glutamatergic synapse
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108590272
   00565 Ether lipid metabolism
    108590272
   00590 Arachidonic acid metabolism
    108590272
   00591 Linoleic acid metabolism
    108590272
   00592 alpha-Linolenic acid metabolism
    108590272
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108590272
   04010 MAPK signaling pathway
    108590272
   04370 VEGF signaling pathway
    108590272
   04072 Phospholipase D signaling pathway
    108590272
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108590272
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108590272
   04664 Fc epsilon RI signaling pathway
    108590272
  09152 Endocrine system
   04912 GnRH signaling pathway
    108590272
   04913 Ovarian steroidogenesis
    108590272
   04921 Oxytocin signaling pathway
    108590272
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108590272
  09156 Nervous system
   04724 Glutamatergic synapse
    108590272
   04726 Serotonergic synapse
    108590272
   04730 Long-term depression
    108590272
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108590272
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    108590272
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108590272
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 108590272
NCBI-ProteinID: XP_017824758
Position
Un
AA seq 132 aa AA seqDB search
MTEKYCLERGIPFPTIEVGPEDMEEARECYLFTKAEDPRSPIVLHFPLVNSTFCTHLAPG
VERQTAEEKAFGDFIINRPDTPYGMMNFTYEPQDFDRLVALSRYNVLNNVETFRCALQLA
LDQQKAREMVGG
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaagtactgcctggaaagaggaatcccctttcctaccatcgaggtgggccct
gaggacatggaggaggccagggagtgctacctgtttaccaaggctgaggacccccgctca
cccatcgtgctgcacttcccccttgttaacagcaccttctgtacacacctggccccaggt
gtggagcgacaaacagctgaggagaaggcctttggggactttatcatcaacaggccagac
accccctatggcatgatgaactttacctatgagcctcaggactttgatcggctggtggcc
ctgagccggtacaatgttctgaacaacgtggagacctttaggtgtgccctccaactggct
ctggaccagcagaaggctcgggagatggttgggggctga

DBGET integrated database retrieval system