KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391747Help
Entry
100391747         CDS       T03264                                 

Gene name
ABCC1
Definition
(RefSeq) ATP binding cassette subfamily C member 1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc02010  ABC transporters
cjc04071  Sphingolipid signaling pathway
cjc04977  Vitamin digestion and absorption
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100391747 (ABCC1)
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100391747 (ABCC1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    100391747 (ABCC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100391747 (ABCC1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100391747 (ABCC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100391747 (ABCC1)
Enzymes [BR:cjc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     100391747 (ABCC1)
Transporters [BR:cjc02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100391747 (ABCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 AAA_25 RsgA_GTPase AAA_22 AAA_29 ABC_ATPase Zeta_toxin Dynamin_N PHO4
Motif
Other DBs
NCBI-GeneID: 100391747
NCBI-ProteinID: XP_017834209
Ensembl: ENSCJAG00000005641
UniProt: U3BTE2
Position
12
AA seq 1531 aa AA seqDB search
MALRGFCRADGSDPLWDWNITWYTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIMTALKADAQVDLFRDISFYVYFT
LVLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLMVQGYRQPLESSD
LWSLNKEDTSEQVVPVLVKNWKKEFAKSRKQPAKVVYSSKDPAKPKGSSKVDVNEEVEAL
IVRSPQKEWNPSLFKVLYKTFGPYFLMSFFFKALHDLMMFAGPEILKLLISFVNDTTAPN
WQGYFYTVLLFVSACLQTLLLHQYFHICFVSGMRIKTAVIGAVYRKALVITSSARKSSTV
GEIVNLMSVDAQRFMDLATYINMVWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPIN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLDIRQEELKVLK
MSAYLAAVGTFTWVCTPFLVALCTFAVYVTVEEKNILDAQKAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPIKDGGGTNSITVRNATFAWARSEPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMEKVEGHVAIKGSLAYVPQQAWIQND
SLRENILFGCQLEERYYKSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYCNSDVYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHGMSYLPQVDIIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDNGVTGISSPGKEAKQMENGL
LVTDRVGKQLQRQLSSSSSYSGDISRCHNSTTELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFVSFLSIFLFMCNHMASLASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGIFASRHLHLDLLDNVLRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPQVIKMFMGSLFNVIGACIIILLATPIAAVIIPPLGLIYFFVQRFYVATSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRQSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPNSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRMNESAEGEIIIDDINIAKIGLHNLRFKITIIPQDPILF
SGSLRMNLDPFSQYSDEEVWMSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEGCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccggggcttctgcagagccgatggctccgacccgctctgggactggaacatc
acgtggtataccagcaaccccgacttcaccaagtgctttcagaacacggtcctcgtgtgg
gtgccttgtttttacctctgggcctgtttccccttctacttcctctatctctcccgacat
gaccggggctacattcagatgacacctctcaataaaaccaaaactgccttgggatttttg
ctgtggatcgtctgctgggcagacctcttctactctttctgggaaagaagtcggggcata
ttcctggccccagtgtttctggtcagcccaactctcttgggcatcaccatgctgcttgct
acctttttaattcagctggagaggcggaagggagttcagtcctcagggatcatgctcact
ttctggctggtagccctgctgtgtgccctagccatcctgagatccaaaatcatgactgcc
ttaaaagcggatgctcaggtggacctgtttcgtgacatcagtttctatgtctactttacc
cttgtgctcattcagctcgtcttgtcctgtttctcagatcgctcacccctgttctcggaa
accatccacgaccctaatccttgcccagagtccagcgcctccttcctatccaggatcacc
ttctggtggatcacagggttgatggtccagggctaccgccagcccctggaaagcagtgac
ctctggtccttaaacaaggaagatacttcggaacaagtcgtgcctgttttggtaaagaac
tggaagaaggaatttgccaagtctaggaagcagcccgcgaaggttgtgtactcctccaag
gatcctgccaagccgaaagggagttccaaggtggatgtgaatgaggaggtggaggctttg
atcgtcaggtctccacagaaggagtggaatccctctctgtttaaggtcttatacaagacc
ttcgggccctacttcctcatgagctttttctttaaggccctccatgacctgatgatgttt
gccggtccggagatcttgaagttgctcatcagctttgtgaatgacaccacggccccaaac
tggcagggctacttctacacagtgctgctgtttgtcagcgcctgcctgcagaccctcctg
ctgcaccagtacttccacatctgctttgtcagcggcatgaggatcaagaccgcggtcatt
ggggctgtttatcgcaaggccctcgtgatcaccagttcagctaggaaatcctcaacggtt
ggggagatcgtcaatcttatgtctgtggatgctcagaggttcatggacttggcgacgtac
attaacatggtctggtcagccccgctgcaagtcattcttgctctctacctcctgtggctg
aacctgggcccgtctgtcctggctggagtggccgtcatggtcctcatggtgccgatcaat
gctgtgatggcaatgaagaccaagacctatcaggtggcccacatgaaaagcaaagacaac
cggatcaagctgatgaatgaaattctcaatgggatcaaagtgctgaagctttatgcctgg
gagctggcgttcaaggagaaggtgttggatatcaggcaggaggagctgaaggtgctgaag
atgtctgcctacctggcagccgtgggtaccttcacttgggtctgcacgcctttcctggtg
gccctctgcacatttgctgtctacgtgaccgttgaagagaagaacatcctggatgcccag
aaagccttcgtgtccttggccttgttcaatatcctccggtttcccctgaacattctcccc
atggtcatcagcagcatcgtgcaggcgagtgtctctctcaaacgcctgaggatctttctg
tctcatgaggagctggaacccgacagcatcgagcggcggcctattaaagacggcgggggc
acaaacagcatcactgtgaggaacgccacattcgcctgggccaggagcgaacctcccaca
ctgaatggcatcaccttctccatcccggaaggtgccttggtggccgtggtgggccaggtg
ggctgcggaaagtcgtcgctgctctcggccctcttggctgagatggagaaagtggagggg
catgtggctatcaagggctcactggcctatgtgcctcagcaggcctggattcagaatgat
tctctccgagaaaacatcctttttggatgtcagctggaggaacggtattataagtccgtg
atacaggcctgtgccctcctcccagacctggaaatcctgcccagtggggatcggaccgag
atcggtgagaagggcgtgaacctgtctgggggccagaagcagcgtgtgagcctggcccgg
gccgtgtactgcaactctgacgtttacctctttgatgatcctctctcggcggtggatgcc
cacgtgggaaagcacatctttgaaaatgtgattggccccaaggggatgctgaagaacaag
acgcggatcttggtcactcatggcatgagctacctgccacaggtggacatcatcattgtc
atgagtggcggcaagatctctgagatgggctcctaccaggagctgcttgcccgggacggt
gccttcgctgagttcctgcgcacctacgccagcgcagagcaggagcaggacccagaggac
aacggagtcacgggcatcagcagtccagggaaggaagcaaagcaaatggagaatggcttg
ctggtgacggacagggtggggaagcaactgcagagacagctcagcagctcctcctcctac
agcggggacatcagcaggtgccacaacagcaccacagagctgcagaaagccgaggccaag
aaggaggagacctggaagctgatggaggctgacaaggcgcagacagggcaggtcaagctt
tccgtgtactgggactacatgaaggccatcggactcttcgtctcctttctcagcatcttc
cttttcatgtgtaaccacatggcctcactggcttccaactattggctcagcctctggact
gatgaccccatcgtcaacgggacccaagagcacacgaaagtccggctgagcgtctatgga
gccctgggcatttcccaagggatcgctgtgtttggctactccatggccgtgtccatcggg
gggatcttcgcttcccgccatctgcacctggacctgttagacaacgtcctgcggtcacct
atgagcttctttgagcggacccccagtgggaacctggtgaaccgcttctccaaggagttg
gacacggtggactccatgatcccgcaggtcatcaagatgttcatgggctccctgttcaac
gtcatcggtgcctgcatcattatcctgctggccacacccattgccgccgtcatcatcccg
cccctcggcctcatctacttcttcgtccagaggttctacgtggccacctcccggcagctg
aagcgcctcgagtcggtcagccgctcccccgtctattcccatttcaatgagaccttgctg
ggggtcagcgttattcgggccttcgaggagcaggaacgcttcatccgccagagtgatctg
aaggtggacgagaaccagaaggcctattaccccagcatcgtggccaacaggtggttggcc
gtgaggctggagtgtgtgggcaactgcattgtcctgttcgcggccctgttcgcggtgatc
tccaggcagagcctcagcgctggcttggtgggtctctccgtgtcttactcattgcaggtc
accacgtacttgaactggctggtccggatgtcatctgagatggaaaccaacattgtggca
gtggagagactcaaggagtattccgaaacggagaaggaggccccctggcaaatccaggag
acagctcctcccaacagctggccccaggtgggccgagtggaattccggaactactgcctg
cgctaccgagaggacctggattttgttctcaggcatatcaatgtcaccatcaatggggga
gaaaaggttggtatcgtggggcggacaggagctgggaagtcgtccctgaccctgggctta
tttcggatgaacgagtctgccgaaggcgaaatcatcatcgatgacatcaacatcgccaag
attggcctgcacaacctccgcttcaagatcaccatcatcccccaggaccctattttgttt
tcgggttccctccgcatgaacctggacccgttcagccaatactcggacgaagaagtctgg
atgtccctggagctggctcacctgaaggacttcgtgtcagcccttcctgacaagctggac
cacgagtgcgcggaaggcggagagaacctcagtgttgggcagcgccagcttgtgtgcctg
gcccgggccctgctgaggaagacgaagatccttgtgttggatgaggccacggcggccgtg
gacctggaaacagacgacctcatccagtccaccatccggacgcagttcgagggctgcact
gtcctcaccatcgcccaccggctcaacaccatcatggactacacaagggtgatcgtcctg
gacaaaggagaaatccaggagtacggcgccccctcggacctcctgcagcagagaggtctc
ttctatagcatggccaaagatgccggcttggtgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414398Help
Entry
100414398         CDS       T03264                                 

Definition
(RefSeq) multidrug resistance-associated protein 1-like
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1 [EC:7.6.2.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc02010  ABC transporters
cjc04071  Sphingolipid signaling pathway
cjc04977  Vitamin digestion and absorption
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100414398
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100414398
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    100414398
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100414398
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100414398
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100414398
Enzymes [BR:cjc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.3  ABC-type glutathione-S-conjugate transporter
     100414398
Transporters [BR:cjc02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100414398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 100414398
NCBI-ProteinID: XP_008988750
Position
12
AA seq 293 aa AA seqDB search
MSILNSRFYVATSRQVKHLESVSRSPVYSHFNETLLGVSVIWTCEEQEHFIHXSDLKVDE
NQKACYPSIVANRWLAVRLECVGNCTVLFAALFAVISRHSLSTGLAGLSVSYSLQVTVYS
NWLVRMSSEMETDIVAMERLEEYSEPEREAPWQIQETALPSSWLQVGRVEFWNYCRCYRE
DLDFVLRYINGEEKVGIMGRTGAGKSSLTLGFVRINEFAEGTIIIDDITIAKIGLHNLCF
KISSPRWGLGATQEDPVLLSRSFCMKLDPFSQYSDSLDVPGAGSPEGLRISPS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctcaactcgaggttctacgtggccacctcccggcaggtgaagcatctcgag
tcggtcagccgctcccctgtctattcccatttcaatgagaccttgctgggggtcagcgtc
atttggacctgtgaggagcaggagcactttatccacncgagtgacctgaaggtggatgag
aaccagaaggcctgttaccccagcattgtggccaacaggtggctggctgtgcgtctggag
tgtgtgggtaactgcactgtcctgtttgctgccctgtttgcagtgatctccaggcacagc
ctcagcactggcttggcgggcctctcagtgtcttactcattgcaggtcaccgtgtactcg
aactggctggttcggatgtcatctgagatggaaaccgacattgtggccatggagagactc
gaggagtattcagaacctgagagggaggcaccctggcaaatccaggaaacagctctgccc
agcagctggctccaggtgggccgagtggaattctggaactactgccggtgctaccgagaa
gacctggattttgttctcaggtacatcaatggggaagaaaaggttggcatcatggggcgg
acgggggcagggaagtcgtccctgaccctgggcttcgttcggatcaacgagtttgccgaa
ggaacgatcatcatcgatgacatcaccattgccaagatcggcctgcacaacctctgcttc
aagatttcatcccccagatggggtctgggtgctacccaagaggaccctgttttgctttcg
cgttccttctgcatgaagctggacccgttcagccagtactcagatagtctggacgtccct
ggagctggctcacctgaaggacttcgcatcagcccttcctga

DBGET integrated database retrieval system