KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391814Help
Entry
100391814         CDS       T03264                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04650  Natural killer cell mediated cytotoxicity
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100391814 (PRKCA)
   04015 Rap1 signaling pathway
    100391814 (PRKCA)
   04010 MAPK signaling pathway
    100391814 (PRKCA)
   04012 ErbB signaling pathway
    100391814 (PRKCA)
   04310 Wnt signaling pathway
    100391814 (PRKCA)
   04370 VEGF signaling pathway
    100391814 (PRKCA)
   04066 HIF-1 signaling pathway
    100391814 (PRKCA)
   04020 Calcium signaling pathway
    100391814 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100391814 (PRKCA)
   04072 Phospholipase D signaling pathway
    100391814 (PRKCA)
   04071 Sphingolipid signaling pathway
    100391814 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100391814 (PRKCA)
   04150 mTOR signaling pathway
    100391814 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100391814 (PRKCA)
   04540 Gap junction
    100391814 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100391814 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100391814 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100391814 (PRKCA)
   04670 Leukocyte transendothelial migration
    100391814 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100391814 (PRKCA)
   04912 GnRH signaling pathway
    100391814 (PRKCA)
   04921 Oxytocin signaling pathway
    100391814 (PRKCA)
   04926 Relaxin signaling pathway
    100391814 (PRKCA)
   04918 Thyroid hormone synthesis
    100391814 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100391814 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100391814 (PRKCA)
   04916 Melanogenesis
    100391814 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100391814 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100391814 (PRKCA)
   04270 Vascular smooth muscle contraction
    100391814 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100391814 (PRKCA)
   04971 Gastric acid secretion
    100391814 (PRKCA)
   04972 Pancreatic secretion
    100391814 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100391814 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100391814 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100391814 (PRKCA)
   04727 GABAergic synapse
    100391814 (PRKCA)
   04725 Cholinergic synapse
    100391814 (PRKCA)
   04728 Dopaminergic synapse
    100391814 (PRKCA)
   04726 Serotonergic synapse
    100391814 (PRKCA)
   04720 Long-term potentiation
    100391814 (PRKCA)
   04730 Long-term depression
    100391814 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100391814 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100391814 (PRKCA)
  09158 Development
   04360 Axon guidance
    100391814 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100391814 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391814 (PRKCA)
   05206 MicroRNAs in cancer
    100391814 (PRKCA)
   05205 Proteoglycans in cancer
    100391814 (PRKCA)
   05231 Choline metabolism in cancer
    100391814 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100391814 (PRKCA)
   05214 Glioma
    100391814 (PRKCA)
   05223 Non-small cell lung cancer
    100391814 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100391814 (PRKCA)
   05032 Morphine addiction
    100391814 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100391814 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100391814 (PRKCA)
   05164 Influenza A
    100391814 (PRKCA)
   05161 Hepatitis B
    100391814 (PRKCA)
   05163 Human cytomegalovirus infection
    100391814 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100391814 (PRKCA)
   05143 African trypanosomiasis
    100391814 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100391814 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100391814 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100391814 (PRKCA)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100391814 (PRKCA)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100391814 (PRKCA)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100391814 (PRKCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Haspin_kinase APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 100391814
NCBI-ProteinID: XP_017828236
Ensembl: ENSCJAG00000000333
Position
5
AA seq 688 aa AA seqDB search
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVTVCTKMHWLQWASRSSCGKGAENFDKFFTRGQPVLTPPDQLV
IANIDQSDFEGFSYVNPQFVHPILQSAV
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcctgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttatggaagccccaccttctgcgatcactgtgggtca
ctgctatatggacttatccatcaagggatgaaatgtgacacctgcgacatgaacgttcac
aagcagtgtgtcatcaatgtccccagcctctgcggaatggatcacacggagaagaggggg
cggatttacctaaaggctgaggttgcggatgaaaagctccatgtcacagtacgagacgca
aaaaatctaatccctatggacccaaacgggctttcagatccttatgtgaagctgaaactc
attcctgatcccaagaacgaaagcaaacaaaaaaccaaaaccatccgctccacgctaaat
ccccagtggaatgagtcctttaccttcaaattgaaaccttcagacaaagaccggcgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctaatgaagatgccagccagtggctggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccggaaggggacgaagaaggaaatgtggag
ctcaggcagaaattcgagaaagccaagcttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcaccgacttcaat
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgctgacaggaaggga
acagaagaactgtacgcaatcaaaatcctgaagaaggacgtggtcattcaggatgatgac
gtggagtgcaccatggtggaaaagagagtcttggccctgctagacaaacccccgttcttg
acacagctgcactcctgcttccagacagtggaccggctgtacttcgtcatggaatacgtc
aacggcggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcagcagagatttccattggattgttcttccttcataaaagaggaatcatt
tatagggacctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccggagataatcgcttatcagccatatggaaaatcggtggac
tggtgggcctatggtgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgaactgtttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggcagtttccatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgcgggcccgagggtgagagggacgtgagagaacatgccttcttccggaggatc
gactgggagaaactggagaacagggagatccagccaccgttcaagcccaaagtgactgtg
tgtaccaaaatgcactggcttcagtgggcctccaggtcttcgtgcggcaaaggagcagaa
aactttgacaagttcttcacacgaggacagcctgtcttaacaccgcccgatcagctggtt
attgctaacatagaccagtctgattttgaagggttctcgtatgtcaacccccagtttgtg
caccccatcttacagagcgcagtatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404028Help
Entry
100404028         CDS       T03264                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04150  mTOR signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04650  Natural killer cell mediated cytotoxicity
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100404028 (PRKCG)
   04015 Rap1 signaling pathway
    100404028 (PRKCG)
   04010 MAPK signaling pathway
    100404028 (PRKCG)
   04012 ErbB signaling pathway
    100404028 (PRKCG)
   04310 Wnt signaling pathway
    100404028 (PRKCG)
   04370 VEGF signaling pathway
    100404028 (PRKCG)
   04066 HIF-1 signaling pathway
    100404028 (PRKCG)
   04020 Calcium signaling pathway
    100404028 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100404028 (PRKCG)
   04071 Sphingolipid signaling pathway
    100404028 (PRKCG)
   04150 mTOR signaling pathway
    100404028 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100404028 (PRKCG)
   04540 Gap junction
    100404028 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100404028 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100404028 (PRKCG)
   04670 Leukocyte transendothelial migration
    100404028 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100404028 (PRKCG)
   04921 Oxytocin signaling pathway
    100404028 (PRKCG)
   04918 Thyroid hormone synthesis
    100404028 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100404028 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100404028 (PRKCG)
   04916 Melanogenesis
    100404028 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100404028 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100404028 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100404028 (PRKCG)
   04971 Gastric acid secretion
    100404028 (PRKCG)
   04972 Pancreatic secretion
    100404028 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100404028 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100404028 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100404028 (PRKCG)
   04727 GABAergic synapse
    100404028 (PRKCG)
   04725 Cholinergic synapse
    100404028 (PRKCG)
   04728 Dopaminergic synapse
    100404028 (PRKCG)
   04726 Serotonergic synapse
    100404028 (PRKCG)
   04720 Long-term potentiation
    100404028 (PRKCG)
   04730 Long-term depression
    100404028 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100404028 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100404028 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100404028 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404028 (PRKCG)
   05206 MicroRNAs in cancer
    100404028 (PRKCG)
   05205 Proteoglycans in cancer
    100404028 (PRKCG)
   05231 Choline metabolism in cancer
    100404028 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100404028 (PRKCG)
   05214 Glioma
    100404028 (PRKCG)
   05223 Non-small cell lung cancer
    100404028 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100404028 (PRKCG)
   05032 Morphine addiction
    100404028 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100404028 (PRKCG)
   05161 Hepatitis B
    100404028 (PRKCG)
   05163 Human cytomegalovirus infection
    100404028 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100404028 (PRKCG)
   05143 African trypanosomiasis
    100404028 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100404028 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100404028 (PRKCG)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100404028 (PRKCG)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100404028 (PRKCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase C1_1 Pkinase_Tyr C2 Pkinase_C Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100404028
NCBI-ProteinID: XP_008986841
Ensembl: ENSCJAG00000018393
UniProt: F7CPU6
Position
22
AA seq 697 aa AA seqDB search
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgt
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcaccggcgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaag
cacaagttccgcctgcacagctacagcagccccaccttctgcgaccactgcggctccctc
ctgtacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcggacgc
ctgcagctggagatccgggctcccactgcggatgagatccacattacggttggtgaggcc
cgtaaccttattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagactcgaacggtgaaagccacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccaggggatgtggagcgtcggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggtgccatgtcc
tttggtgtctcagagctgctcaaggcgccggtggacggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccagtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctcccccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcgagcccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctccgatgagctctacgccatcaag
atcctgaaaaaggatgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgcgtgctggcgctgggaggccggggtcctggcggccggcctcacttcctcacccagctc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtatgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggtatcatctacagggac
ctgaagctggacaatgtgatgctagatgctgagggacacatcaagatcactgacttcggc
atgtgtaaggagaacgtcttccccgggactacaacccgcaccttctgtgggaccccggac
tacatagccccagagatcattgcctaccagccctatgggaagtctgtggattggtggtcc
ttcggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgaa
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctgtcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
ggacctgatggggaacccaccatccgtgcacacggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagtggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcctgtcatgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410136Help
Entry
100410136         CDS       T03264                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04071  Sphingolipid signaling pathway
cjc04150  mTOR signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04650  Natural killer cell mediated cytotoxicity
cjc04662  B cell receptor signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05140  Leishmaniasis
cjc05143  African trypanosomiasis
cjc05146  Amoebiasis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100410136 (PRKCB)
   04015 Rap1 signaling pathway
    100410136 (PRKCB)
   04010 MAPK signaling pathway
    100410136 (PRKCB)
   04012 ErbB signaling pathway
    100410136 (PRKCB)
   04310 Wnt signaling pathway
    100410136 (PRKCB)
   04370 VEGF signaling pathway
    100410136 (PRKCB)
   04064 NF-kappa B signaling pathway
    100410136 (PRKCB)
   04066 HIF-1 signaling pathway
    100410136 (PRKCB)
   04020 Calcium signaling pathway
    100410136 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100410136 (PRKCB)
   04071 Sphingolipid signaling pathway
    100410136 (PRKCB)
   04150 mTOR signaling pathway
    100410136 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100410136 (PRKCB)
   04540 Gap junction
    100410136 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100410136 (PRKCB)
   04662 B cell receptor signaling pathway
    100410136 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100410136 (PRKCB)
   04670 Leukocyte transendothelial migration
    100410136 (PRKCB)
   04062 Chemokine signaling pathway
    100410136 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100410136 (PRKCB)
   04912 GnRH signaling pathway
    100410136 (PRKCB)
   04921 Oxytocin signaling pathway
    100410136 (PRKCB)
   04918 Thyroid hormone synthesis
    100410136 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100410136 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100410136 (PRKCB)
   04916 Melanogenesis
    100410136 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100410136 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100410136 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100410136 (PRKCB)
   04971 Gastric acid secretion
    100410136 (PRKCB)
   04972 Pancreatic secretion
    100410136 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100410136 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100410136 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100410136 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100410136 (PRKCB)
   04727 GABAergic synapse
    100410136 (PRKCB)
   04725 Cholinergic synapse
    100410136 (PRKCB)
   04728 Dopaminergic synapse
    100410136 (PRKCB)
   04726 Serotonergic synapse
    100410136 (PRKCB)
   04720 Long-term potentiation
    100410136 (PRKCB)
   04730 Long-term depression
    100410136 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100410136 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100410136 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100410136 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410136 (PRKCB)
   05206 MicroRNAs in cancer
    100410136 (PRKCB)
   05205 Proteoglycans in cancer
    100410136 (PRKCB)
   05231 Choline metabolism in cancer
    100410136 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100410136 (PRKCB)
   05214 Glioma
    100410136 (PRKCB)
   05223 Non-small cell lung cancer
    100410136 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100410136 (PRKCB)
   05032 Morphine addiction
    100410136 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100410136 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100410136 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100410136 (PRKCB)
   05164 Influenza A
    100410136 (PRKCB)
   05161 Hepatitis B
    100410136 (PRKCB)
   05163 Human cytomegalovirus infection
    100410136 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100410136 (PRKCB)
   05140 Leishmaniasis
    100410136 (PRKCB)
   05143 African trypanosomiasis
    100410136 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100410136 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100410136 (PRKCB)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100410136 (PRKCB)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100410136 (PRKCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Haspin_kinase Kinase-like CEP76-C2 APH
Motif
Other DBs
NCBI-GeneID: 100410136
NCBI-ProteinID: XP_002756047
Ensembl: ENSCJAG00000020643
UniProt: F7I4K6
Position
12
AA seq 671 aa AA seqDB search
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagtgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaatgtgcacgaggtcaagaaccacaaattcact
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccccggagctgacaagggtccagcctctgatgacccccggagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccattgtgggtcg
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaatgtccccagcctgtgtggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagggacgtcctcattgtcctcgtaagagacgct
aaaaacctggtacctatggaccccaatggcttgtcagatccctacgtaaaactgaaactg
attcctgatcctaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaat
cccgagtggaatgagacatttagatttcagctgaaagaatcggacaaggacagaagactg
tcagtagagatttgggactgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaactgcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtcccaccagaaggaagtgagggcaatgaagaa
ctgcggcagaaattcgagagggccaagatcagtcagggaaccaaggtcccagaagaaaag
acgaccaacactgtctccaaatttgacaacaatggcaacagagaccggatgaaactgacc
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggacgtcgtaatccaa
gatgatgacgtggagtgcaccatggtggagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctccactcctgcttccagactatggaccgcctgtactttgtgatg
gagtacgtgaatgggggcgacctcatgtatcacatccagcaagtcggccggttcaaggag
ccccatgctgtattttacgctgcagaaattgcaatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctggattctgaggggcacatc
aagattgctgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tctgtggattggtgggcgtttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaagatgaagatgagctcttccagtccatcatggaacacaatgtagcctat
cccaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctaggttgcggacctgaaggcgaacgtgacatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccatataagccaaaa
gctagagacaagagagacacctccaacttcgacaaagagttcaccagacagcccgtggaa
ctgactcccactgataaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcttacactaacccagagtttgtcattaatgtgtag

DBGET integrated database retrieval system