KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391927Help
Entry
100391927         CDS       T03264                                 

Gene name
RARS2
Definition
(RefSeq) arginyl-tRNA synthetase 2, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100391927 (RARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjc01007]
    100391927 (RARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjc03016]
    100391927 (RARS2)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100391927 (RARS2)
Enzymes [BR:cjc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     100391927 (RARS2)
Amino acid related enzymes [BR:cjc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   100391927 (RARS2)
Transfer RNA biogenesis [BR:cjc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100391927 (RARS2)
 Prokaryotic Type
   Other AARSs
    100391927 (RARS2)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100391927 (RARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1
Motif
Other DBs
NCBI-GeneID: 100391927
NCBI-ProteinID: XP_002746843
Ensembl: ENSCJAG00000000692
UniProt: U3BS49
Position
4
AA seq 578 aa AA seqDB search
MACGFRRVIACQLSRVLDLPPENLIKSISAVPISKNEEAADFQLSVDSLLEKDNDHSRPD
IQVHAKRLAEKLRCDTVVSEISTGERTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFS
DLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVIRINYLGDWGMQFGL
LGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADDKSVAKSAQEFFQRLEEGDVRALSL
WQKFRDLSIEEYIRIYKRLGIYFDEYSGESFYREKSQEVLKLLESKGLLLKTIKGTAVID
LSGNGDPSSICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQM
LKLMGYDWAERCQHVPFGVVQGMKTRRGDVTFLEDVLNEIQLRMLQNMASIKTTKELKNP
QETAERVGLAALIIQDFKGLLLSDYKFNWDRVFQSRGDTGVFLQYTHARLHSLEETFGCG
YLNDFNTACLQEPQSVSILQHLLRFDEVLYRSSQDLQPRHIVSYLLTLSHLAAVAHKTLQ
IKDSPPEVAGARLRLFKAVRSVLANGMKLLGITPVCRM
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcggctttcgccgggttatagcttgccagctttctagagtgttggatcttcca
ccagaaaacttgatcaagtcaatatctgcagttccaatttccaaaaatgaagaagcagct
gattttcagctttccgtggattctttattggaaaaagacaatgaccattcaagaccagat
attcaagttcatgccaagagactagcagagaagctaagatgtgatacagtggtgagtgaa
atcagtactggtgaaaggactgtaaatttcaaaataaacagagagctcttaacaaagaca
gtattacaacaagtcattgaagatggctcaaaatatggattaaaaagtgaacttttctct
gatcttccccagaagaagattgtggttgaattcagttcacctaatgttgctaaaaaattt
catgttggacatttgcgttctacgatcataggaaattttatagcaaatctcaaagaagct
ttaggacatcaagtaataagaataaattaccttggcgattggggcatgcagtttggtctt
ctgggaactggcttccaactatttggctatgaagaaaaactgcagtccaatcctttacag
catctctttgaagtttatgtacaagttaataaagaagcagcagatgataaaagtgtagca
aaatcggcacaggagttcttccagcgattggaagagggcgatgtgcgagcactttcactg
tggcaaaaattccgggacttgagcattgaagagtatattcggatttacaagcgtctggga
atatattttgatgaatattcaggagaatcattttatcgtgaaaaatctcaagaagtctta
aagttgctggagagtaaaggactcctactgaaaacaataaaaggaactgctgtaatagat
ctatctgggaatggtgacccctcttcaatttgtactgtaatgcgaagtgatgggacttct
ctctatgcaaccagagatcttgcagctgctatagatcgaatggacaagtataattttgat
acaatgatatatgtgacagataaaggacaaaaaaagcattttcagcaagtattccaaatg
ctgaagctcatgggatatgactgggcagaaaggtgccagcacgtgccctttggagtagtg
cagggaatgaagactcgaagaggagatgtcacttttctggaagatgttttaaatgagatt
caattaaggatgctacagaacatggcttccattaagacaactaaagaactcaaaaaccca
caggagactgcagagagggtcggacttgcagcactcattattcaggacttcaaaggttta
ctcttatctgactacaagttcaactgggatcgtgttttccagagtcgtggggacacagga
gtcttcctgcaatacacacacgcccgcctccacagtttggaagagacttttggatgtggt
tacctgaatgacttcaacactgcttgtttacaagagccacagtctgtttcaattctccag
catcttctcaggttcgacgaggtgctttatagatcatctcaagaccttcaacccaggcat
attgtcagttaccttctaactttaagtcatcttgcagccgtggcacacaaaacactacaa
ataaaagatagtcctcctgaagtggctggggccagacttcgtcttttcaaagctgtccgt
tctgtcctagccaatggaatgaaacttcttggaataacacctgtatgtaggatgtaa

DBGET integrated database retrieval system