KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392123Help
Entry
100392123         CDS       T03264                                 

Gene name
PRKACG
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04976  Bile secretion
cjc05012  Parkinson disease
cjc05020  Prion diseases
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100392123 (PRKACG)
   04010 MAPK signaling pathway
    100392123 (PRKACG)
   04310 Wnt signaling pathway
    100392123 (PRKACG)
   04340 Hedgehog signaling pathway
    100392123 (PRKACG)
   04371 Apelin signaling pathway
    100392123 (PRKACG)
   04020 Calcium signaling pathway
    100392123 (PRKACG)
   04024 cAMP signaling pathway
    100392123 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100392123 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100392123 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100392123 (PRKACG)
   04540 Gap junction
    100392123 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100392123 (PRKACG)
   04062 Chemokine signaling pathway
    100392123 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    100392123 (PRKACG)
   04910 Insulin signaling pathway
    100392123 (PRKACG)
   04922 Glucagon signaling pathway
    100392123 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    100392123 (PRKACG)
   04912 GnRH signaling pathway
    100392123 (PRKACG)
   04913 Ovarian steroidogenesis
    100392123 (PRKACG)
   04915 Estrogen signaling pathway
    100392123 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    100392123 (PRKACG)
   04921 Oxytocin signaling pathway
    100392123 (PRKACG)
   04926 Relaxin signaling pathway
    100392123 (PRKACG)
   04918 Thyroid hormone synthesis
    100392123 (PRKACG)
   04919 Thyroid hormone signaling pathway
    100392123 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    100392123 (PRKACG)
   04916 Melanogenesis
    100392123 (PRKACG)
   04924 Renin secretion
    100392123 (PRKACG)
   04925 Aldosterone synthesis and secretion
    100392123 (PRKACG)
   04927 Cortisol synthesis and secretion
    100392123 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100392123 (PRKACG)
   04270 Vascular smooth muscle contraction
    100392123 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    100392123 (PRKACG)
   04971 Gastric acid secretion
    100392123 (PRKACG)
   04976 Bile secretion
    100392123 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100392123 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100392123 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100392123 (PRKACG)
   04727 GABAergic synapse
    100392123 (PRKACG)
   04725 Cholinergic synapse
    100392123 (PRKACG)
   04728 Dopaminergic synapse
    100392123 (PRKACG)
   04726 Serotonergic synapse
    100392123 (PRKACG)
   04720 Long-term potentiation
    100392123 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    100392123 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    100392123 (PRKACG)
   04742 Taste transduction
    100392123 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    100392123 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    100392123 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    100392123 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100392123 (PRKACG)
   04714 Thermogenesis
    100392123 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392123 (PRKACG)
   05205 Proteoglycans in cancer
    100392123 (PRKACG)
   05203 Viral carcinogenesis
    100392123 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100392123 (PRKACG)
   05020 Prion diseases
    100392123 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    100392123 (PRKACG)
   05031 Amphetamine addiction
    100392123 (PRKACG)
   05032 Morphine addiction
    100392123 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100392123 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100392123 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392123 (PRKACG)
   05163 Human cytomegalovirus infection
    100392123 (PRKACG)
   05165 Human papillomavirus infection
    100392123 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100392123 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100392123 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100392123 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100392123 (PRKACG)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100392123 (PRKACG)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100392123 (PRKACG)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKA family
   100392123 (PRKACG)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100392123 (PRKACG)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100392123 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH FTA2 Kdo Seadorna_VP7 RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100392123
NCBI-ProteinID: XP_008994190
Position
1
AA seq 349 aa AA seqDB search
MDNAPAKKDTKQEVKEFLARAKEDFLYRWEHPVQNTASSDQFELLKTLGAGSFGRVVLVR
HQESGGHYAMKILNKQKVVKLKQVEQVLSEKRILQAINFPFLVKLQFSFRDNSNLYLVME
YVPGGDMFSRLRRVGKFREPHACFCAAQIVLAFQYLHSRDLIHRDLKPENIVIDQQGYLR
VTDFGFAKRVRGRTWTLCGTPEYLAPEIILNKGYSKAVDWWALGVLTYEMAMGFPPFYAD
QAVQIYQKIVSGKVQFPSHVSSDLKDLLRNLLQVDLSKRFGNLRNGVGDIKNHKWFTTTN
WIAIYEKKVKAPFIPKLAGPGDASNFDNYEEEEIWISINEKCANEFSEF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgctcccgccaagaaggacaccaagcaggaggtgaaagagttcctagccaga
gccaaagaagatttcctctacagatgggaacaccctgttcagaacaccgccagctcggat
cagtttgaactgctcaagacgctgggcgcgggctccttcgggcgggtggtgctggtgagg
caccaggagagcggcggccactacgccatgaagatcctcaacaagcagaaggtggtgaaa
ctgaagcaggtcgagcaagtcctgagcgagaagcgcatcctgcaggcgatcaactttccg
ttccttgtcaagctccagttctccttcagggacaactccaacctgtacctggtgatggag
tacgtgccgggtggggacatgttctcccgcctacggcgcgttggaaagttcagagagccc
catgcctgtttctgtgccgcccagatcgtcctggccttccagtacctgcactcgcgcgac
ctcatccaccgcgacctgaagcccgagaacatcgtcatcgaccagcagggctacctgcgg
gtgacggacttcggtttcgccaagcgcgtgaggggccgcacttggaccctgtgcgggacc
cccgagtaccttgcccccgagatcatcctgaacaaaggctacagcaaggccgtggactgg
tgggccctgggggtgctcacctatgagatggccatgggcttcccgcccttctatgctgac
caggcggtccaaatctaccagaagatcgtctctgggaaggtgcagttcccctcccacgtc
agctctgacctcaaggacctgctgcggaacctgctgcaggtggacctctccaagcgcttc
gggaacctccggaatggggtcggcgacatcaagaaccacaagtggttcaccacaaccaat
tggattgccatctatgagaagaaggtgaaagctcccttcatcccgaagttggcaggccct
ggggatgccagtaactttgacaactacgaggaggaagagatctggatctccatcaacgag
aagtgtgccaacgagttttctgagttttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400737Help
Entry
100400737         CDS       T03264                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04976  Bile secretion
cjc05012  Parkinson disease
cjc05020  Prion diseases
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100400737 (PRKACA)
   04010 MAPK signaling pathway
    100400737 (PRKACA)
   04310 Wnt signaling pathway
    100400737 (PRKACA)
   04340 Hedgehog signaling pathway
    100400737 (PRKACA)
   04371 Apelin signaling pathway
    100400737 (PRKACA)
   04020 Calcium signaling pathway
    100400737 (PRKACA)
   04024 cAMP signaling pathway
    100400737 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100400737 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100400737 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100400737 (PRKACA)
   04540 Gap junction
    100400737 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100400737 (PRKACA)
   04062 Chemokine signaling pathway
    100400737 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    100400737 (PRKACA)
   04910 Insulin signaling pathway
    100400737 (PRKACA)
   04922 Glucagon signaling pathway
    100400737 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    100400737 (PRKACA)
   04912 GnRH signaling pathway
    100400737 (PRKACA)
   04913 Ovarian steroidogenesis
    100400737 (PRKACA)
   04915 Estrogen signaling pathway
    100400737 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100400737 (PRKACA)
   04921 Oxytocin signaling pathway
    100400737 (PRKACA)
   04926 Relaxin signaling pathway
    100400737 (PRKACA)
   04918 Thyroid hormone synthesis
    100400737 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100400737 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100400737 (PRKACA)
   04916 Melanogenesis
    100400737 (PRKACA)
   04924 Renin secretion
    100400737 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100400737 (PRKACA)
   04927 Cortisol synthesis and secretion
    100400737 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100400737 (PRKACA)
   04270 Vascular smooth muscle contraction
    100400737 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    100400737 (PRKACA)
   04971 Gastric acid secretion
    100400737 (PRKACA)
   04976 Bile secretion
    100400737 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100400737 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100400737 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100400737 (PRKACA)
   04727 GABAergic synapse
    100400737 (PRKACA)
   04725 Cholinergic synapse
    100400737 (PRKACA)
   04728 Dopaminergic synapse
    100400737 (PRKACA)
   04726 Serotonergic synapse
    100400737 (PRKACA)
   04720 Long-term potentiation
    100400737 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100400737 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    100400737 (PRKACA)
   04742 Taste transduction
    100400737 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100400737 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    100400737 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100400737 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100400737 (PRKACA)
   04714 Thermogenesis
    100400737 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400737 (PRKACA)
   05205 Proteoglycans in cancer
    100400737 (PRKACA)
   05203 Viral carcinogenesis
    100400737 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100400737 (PRKACA)
   05020 Prion diseases
    100400737 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    100400737 (PRKACA)
   05031 Amphetamine addiction
    100400737 (PRKACA)
   05032 Morphine addiction
    100400737 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100400737 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100400737 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100400737 (PRKACA)
   05163 Human cytomegalovirus infection
    100400737 (PRKACA)
   05165 Human papillomavirus infection
    100400737 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100400737 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100400737 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100400737 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100400737 (PRKACA)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100400737 (PRKACA)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100400737 (PRKACA)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKA family
   100400737 (PRKACA)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100400737 (PRKACA)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100400737 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100400737
NCBI-ProteinID: XP_008985660
Ensembl: ENSCJAG00000004906
Position
22
AA seq 293 aa AA seqDB search
MLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLY
MVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWF
ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFNEF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacag
aaggtggtaaagctgaaacagatagaacacaccctgaatgaaaagcgcatcctgcaagcc
gtcaactttccgttcctcgtcagactggagttctccttcaaggacaactcaaacttatac
atggtcatggagtacgtgcctggcggggagatgttctcacacctacggcggattggaagg
ttcagtgagccccatgcccgtttctacgcggcccagatcgtcctgaccttcgaatatctg
cactcgctggatctcatctacagggacctgaagccagagaatctgctcatcgaccagcag
ggctacattcaggtgacagacttcggtttcgccaagcgtgtgaagggccgcacttggacc
ttatgtgggacccctgagtacctggcccccgagatcatcctgagcaaaggctacaacaag
gctgtggactggtgggccctaggggttcttatctatgagatggccgctggctacccgccc
ttcttcgcagaccagcccatccagatctatgagaagatcgtctctggaaaggtgcggttc
ccttcccacttcagctctgacttgaaggacctcctgcggaacctcctgcaggtagatctc
accaagcgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggttt
gccacgactgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaag
tttaaaggccctggggacacgagtaactttgacgactatgaggaagaagaaatccgggtc
tccatcaatgagaagtgtggcaaggagtttaatgagttttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407692Help
Entry
100407692         CDS       T03264                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04976  Bile secretion
cjc05012  Parkinson disease
cjc05020  Prion diseases
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100407692 (PRKACB)
   04010 MAPK signaling pathway
    100407692 (PRKACB)
   04310 Wnt signaling pathway
    100407692 (PRKACB)
   04340 Hedgehog signaling pathway
    100407692 (PRKACB)
   04371 Apelin signaling pathway
    100407692 (PRKACB)
   04020 Calcium signaling pathway
    100407692 (PRKACB)
   04024 cAMP signaling pathway
    100407692 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100407692 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100407692 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100407692 (PRKACB)
   04540 Gap junction
    100407692 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100407692 (PRKACB)
   04062 Chemokine signaling pathway
    100407692 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    100407692 (PRKACB)
   04910 Insulin signaling pathway
    100407692 (PRKACB)
   04922 Glucagon signaling pathway
    100407692 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    100407692 (PRKACB)
   04912 GnRH signaling pathway
    100407692 (PRKACB)
   04913 Ovarian steroidogenesis
    100407692 (PRKACB)
   04915 Estrogen signaling pathway
    100407692 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100407692 (PRKACB)
   04921 Oxytocin signaling pathway
    100407692 (PRKACB)
   04926 Relaxin signaling pathway
    100407692 (PRKACB)
   04918 Thyroid hormone synthesis
    100407692 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100407692 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    100407692 (PRKACB)
   04916 Melanogenesis
    100407692 (PRKACB)
   04924 Renin secretion
    100407692 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100407692 (PRKACB)
   04927 Cortisol synthesis and secretion
    100407692 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100407692 (PRKACB)
   04270 Vascular smooth muscle contraction
    100407692 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    100407692 (PRKACB)
   04971 Gastric acid secretion
    100407692 (PRKACB)
   04976 Bile secretion
    100407692 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100407692 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100407692 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100407692 (PRKACB)
   04727 GABAergic synapse
    100407692 (PRKACB)
   04725 Cholinergic synapse
    100407692 (PRKACB)
   04728 Dopaminergic synapse
    100407692 (PRKACB)
   04726 Serotonergic synapse
    100407692 (PRKACB)
   04720 Long-term potentiation
    100407692 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100407692 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    100407692 (PRKACB)
   04742 Taste transduction
    100407692 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100407692 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    100407692 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100407692 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100407692 (PRKACB)
   04714 Thermogenesis
    100407692 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407692 (PRKACB)
   05205 Proteoglycans in cancer
    100407692 (PRKACB)
   05203 Viral carcinogenesis
    100407692 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100407692 (PRKACB)
   05020 Prion diseases
    100407692 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    100407692 (PRKACB)
   05031 Amphetamine addiction
    100407692 (PRKACB)
   05032 Morphine addiction
    100407692 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100407692 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100407692 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100407692 (PRKACB)
   05163 Human cytomegalovirus infection
    100407692 (PRKACB)
   05165 Human papillomavirus infection
    100407692 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100407692 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100407692 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100407692 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100407692 (PRKACB)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100407692 (PRKACB)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100407692 (PRKACB)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKA family
   100407692 (PRKACB)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100407692 (PRKACB)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100407692 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100407692
NCBI-ProteinID: XP_002751055
Ensembl: ENSCJAG00000007331
UniProt: F6YD93
Position
7
AA seq 398 aa AA seqDB search
MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCGREFDEF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttatagagaaccaccttgtaaccagtatacaggtacaactacagctcttcag
aaattggaaggttttgctagccggttatttcatagacactccaaaggtactgcacatgat
cagaaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggac
agatcaatgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaat
ccaactccgagtaatgctggacttgaagattttgaaaggaaaaaaacccttggaacaggt
tcatttggaagagtcatgttggtaaaacacaaagccactgaacagtattatgccatgaag
atcttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaa
agaatattacaggcagtgaattttcctttccttgttcgactggagtatgcttttaaggat
aattctaatttatacatggttatggaatacgtccctgggggtgaaatgttttcacatcta
agaagaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtacta
acattcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctc
ttaattgaccatcaaggctatatccaggtcacagactttggatttgccaaaagagttaaa
ggcagaacttggacattatgtggaactccagagtatttggctccagaaataattctcagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttct
ggaaaggtccgattcccatctcacttcagctcagatctcaaggaccttctacggaacctg
ctgcaggtggatttgaccaagagatttggaaatctaaagaacggtgtcagtgatataaaa
actcacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtgtctataacagaaaaatgtggaagagaatttgatgaattttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407753Help
Entry
100407753         CDS       T03264                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04976  Bile secretion
cjc05012  Parkinson disease
cjc05020  Prion diseases
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100407753
   04010 MAPK signaling pathway
    100407753
   04310 Wnt signaling pathway
    100407753
   04340 Hedgehog signaling pathway
    100407753
   04371 Apelin signaling pathway
    100407753
   04020 Calcium signaling pathway
    100407753
   04024 cAMP signaling pathway
    100407753
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100407753
  09143 Cell growth and death
   04114 Oocyte meiosis
    100407753
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100407753
   04540 Gap junction
    100407753
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100407753
   04062 Chemokine signaling pathway
    100407753
  09152 Endocrine system
   04911 Insulin secretion
    100407753
   04910 Insulin signaling pathway
    100407753
   04922 Glucagon signaling pathway
    100407753
   04923 Regulation of lipolysis in adipocytes
    100407753
   04912 GnRH signaling pathway
    100407753
   04913 Ovarian steroidogenesis
    100407753
   04915 Estrogen signaling pathway
    100407753
   04914 Progesterone-mediated oocyte maturation
    100407753
   04921 Oxytocin signaling pathway
    100407753
   04926 Relaxin signaling pathway
    100407753
   04918 Thyroid hormone synthesis
    100407753
   04919 Thyroid hormone signaling pathway
    100407753
   04928 Parathyroid hormone synthesis, secretion and action
    100407753
   04916 Melanogenesis
    100407753
   04924 Renin secretion
    100407753
   04925 Aldosterone synthesis and secretion
    100407753
   04927 Cortisol synthesis and secretion
    100407753
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100407753
   04270 Vascular smooth muscle contraction
    100407753
  09154 Digestive system
   04970 Salivary secretion
    100407753
   04971 Gastric acid secretion
    100407753
   04976 Bile secretion
    100407753
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100407753
   04961 Endocrine and other factor-regulated calcium reabsorption
    100407753
  09156 Nervous system
   04724 Glutamatergic synapse
    100407753
   04727 GABAergic synapse
    100407753
   04725 Cholinergic synapse
    100407753
   04728 Dopaminergic synapse
    100407753
   04726 Serotonergic synapse
    100407753
   04720 Long-term potentiation
    100407753
   04723 Retrograde endocannabinoid signaling
    100407753
  09157 Sensory system
   04740 Olfactory transduction
    100407753
   04742 Taste transduction
    100407753
   04750 Inflammatory mediator regulation of TRP channels
    100407753
  09149 Aging
   04211 Longevity regulating pathway
    100407753
   04213 Longevity regulating pathway - multiple species
    100407753
  09159 Environmental adaptation
   04713 Circadian entrainment
    100407753
   04714 Thermogenesis
    100407753
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407753
   05205 Proteoglycans in cancer
    100407753
   05203 Viral carcinogenesis
    100407753
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100407753
   05020 Prion diseases
    100407753
  09165 Substance dependence
   05030 Cocaine addiction
    100407753
   05031 Amphetamine addiction
    100407753
   05032 Morphine addiction
    100407753
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100407753
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100407753
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100407753
   05163 Human cytomegalovirus infection
    100407753
   05165 Human papillomavirus infection
    100407753
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100407753
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100407753
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100407753
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100407753
   03036 Chromosome and associated proteins [BR:cjc03036]
    100407753
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100407753
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKA family
   100407753
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100407753
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100407753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100407753
NCBI-ProteinID: XP_008988899
Position
2
AA seq 377 aa AA seqDB search
MGNVPAKDTEQKVVKEFIAGAKEDFLRRWERPVQNTARLDQFKLLKTLGIGSFGRVVLVS
HRESGSHYAMKILNKEKVVRLKQVQHVLNEKRILQAIDFPFLVKLHFSFRDNSNLYLVME
YVPGGDMFSHLQRVGRFTEPHAGFYAAQIVLAFQYLHSLDLIHRDLKPENTVIDQQGYLR
VTDFGFAKRVRGRTWTLCGTPEYLAPEIILNKGYSKAVDWWTLGVLIYEMAVGFPPFYAD
QRNSVFQNILSGKVRFPSHVSSDLKDLLRNLLQVDLSKRFGNLRNGVGDIKNHKWFPKTS
WITLCEKKVEAPFIPKFEGPGDASNFDNYEEEEIRISIKEKSSTGWPWASRPSMQTSRST
SSKTSSLGRCGSHFLGI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtgcccgccaaggacaccgagcagaaggtcgtgaaagagttcatagccgga
gccaaagaagatttcctccgtagatgggaacgcccggttcagaacaccgcccgcttggat
cagtttaaactgctcaagacgctgggcatcggctccttcgggcgggtggtcctggtgagt
caccgggagagcggcagccactatgccatgaagatcctcaacaaggagaaggtggtgaga
ctgaaacaggtccagcacgtcctgaacgagaagcgcatcctgcaggcgatcgactttccg
ttcctcgtcaagctccatttctccttcagggacaactccaacctgtacctggtgatggag
tacgtgccgggtggggacatgttctcccacctacagcgcgtcggaaggttcacagagccc
catgccggtttctatgccgcccagatcgtcctggccttccagtacttgcactcgctcgac
ctcatccaccgcgacctgaagcccgagaacaccgtcatcgaccagcagggctacctgcgg
gtgaccgacttcggtttcgccaagcgcgtgaggggccgcacttggaccctgtgcgggacc
ccagagtacctggcccccgagatcatcctgaacaaaggctacagcaaggccgtggactgg
tggaccctgggggtgctcatctacgagatggccgtgggcttcccgcccttctacgccgac
cagcggaattccgtcttccaaaacatcctctccgggaaggtgcggttcccctcccacgtc
agctctgacctcaaggacctgctgcggaacctgctgcaggtggacctctccaagcgcttc
gggaacctccggaacggggtcggcgacattaagaaccacaagtggttccccaaaaccagt
tggatcaccctctgtgagaagaaggtggaagctcccttcatcccgaagttcgaaggccct
ggggatgccagtaactttgacaactacgaggaggaagagatccgcatctccatcaaggag
aagtcttctacgggatggccgtgggcttcccgcccttctatgcagaccagcagatccacg
tcttcgaaaacatcttctctgggaaggtgcggttcccattttcttggcatataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408115Help
Entry
100408115         CDS       T03264                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04371  Apelin signaling pathway
cjc04530  Tight junction
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04740  Olfactory transduction
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04976  Bile secretion
cjc05012  Parkinson disease
cjc05020  Prion diseases
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05032  Morphine addiction
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Module
cjc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100408115
   04010 MAPK signaling pathway
    100408115
   04310 Wnt signaling pathway
    100408115
   04340 Hedgehog signaling pathway
    100408115
   04371 Apelin signaling pathway
    100408115
   04020 Calcium signaling pathway
    100408115
   04024 cAMP signaling pathway
    100408115
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100408115
  09143 Cell growth and death
   04114 Oocyte meiosis
    100408115
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100408115
   04540 Gap junction
    100408115
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100408115
   04062 Chemokine signaling pathway
    100408115
  09152 Endocrine system
   04911 Insulin secretion
    100408115
   04910 Insulin signaling pathway
    100408115
   04922 Glucagon signaling pathway
    100408115
   04923 Regulation of lipolysis in adipocytes
    100408115
   04912 GnRH signaling pathway
    100408115
   04913 Ovarian steroidogenesis
    100408115
   04915 Estrogen signaling pathway
    100408115
   04914 Progesterone-mediated oocyte maturation
    100408115
   04921 Oxytocin signaling pathway
    100408115
   04926 Relaxin signaling pathway
    100408115
   04918 Thyroid hormone synthesis
    100408115
   04919 Thyroid hormone signaling pathway
    100408115
   04928 Parathyroid hormone synthesis, secretion and action
    100408115
   04916 Melanogenesis
    100408115
   04924 Renin secretion
    100408115
   04925 Aldosterone synthesis and secretion
    100408115
   04927 Cortisol synthesis and secretion
    100408115
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100408115
   04270 Vascular smooth muscle contraction
    100408115
  09154 Digestive system
   04970 Salivary secretion
    100408115
   04971 Gastric acid secretion
    100408115
   04976 Bile secretion
    100408115
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100408115
   04961 Endocrine and other factor-regulated calcium reabsorption
    100408115
  09156 Nervous system
   04724 Glutamatergic synapse
    100408115
   04727 GABAergic synapse
    100408115
   04725 Cholinergic synapse
    100408115
   04728 Dopaminergic synapse
    100408115
   04726 Serotonergic synapse
    100408115
   04720 Long-term potentiation
    100408115
   04723 Retrograde endocannabinoid signaling
    100408115
  09157 Sensory system
   04740 Olfactory transduction
    100408115
   04742 Taste transduction
    100408115
   04750 Inflammatory mediator regulation of TRP channels
    100408115
  09149 Aging
   04211 Longevity regulating pathway
    100408115
   04213 Longevity regulating pathway - multiple species
    100408115
  09159 Environmental adaptation
   04713 Circadian entrainment
    100408115
   04714 Thermogenesis
    100408115
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408115
   05205 Proteoglycans in cancer
    100408115
   05203 Viral carcinogenesis
    100408115
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100408115
   05020 Prion diseases
    100408115
  09165 Substance dependence
   05030 Cocaine addiction
    100408115
   05031 Amphetamine addiction
    100408115
   05032 Morphine addiction
    100408115
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100408115
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100408115
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100408115
   05163 Human cytomegalovirus infection
    100408115
   05165 Human papillomavirus infection
    100408115
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100408115
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100408115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100408115
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100408115
   03036 Chromosome and associated proteins [BR:cjc03036]
    100408115
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100408115
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKA family
   100408115
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100408115
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100408115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 100408115
NCBI-ProteinID: XP_008988914
Ensembl: ENSCJAG00000022277
Position
2
AA seq 349 aa AA seqDB search
MGNVPAKDTEQKVVKEFIAGAKEDFLRRWERPVQNTARLDQFKLLKTLGIGSFGRVVLVS
HRESGSHYAMKILNKEKVVRLKQVQHVLNEKRILQAIDFPFLVKLHFSFRDNSNLYLVME
YVPGGDVFSHLQRVGRFTEPHAGFYAAQIVLAFQYLHSLDLIHRDLKPENIVIDQQGYLR
VTDFGFAKRVRGRTWTLCGTPEYLAPEIILNKGYSKAVDWWTLGVLIYEMAVGFPPFYAD
QRNSVFQNILSGKVRFPSHVSSDLKNLLRNLLQVDLSKRFGNLRNGVGDIKNHKWFATTN
WIAIYEKQVEAPFIPKFAGPGDASNFDNYEEEEIRISINEKYANEFSQF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtgcccgccaaggacaccgagcagaaggtcgtgaaagagttcatagccgga
gccaaagaagatttcctccgtagatgggaacgcccggttcagaacaccgcccgcttggat
cagtttaaactgctcaagacgctgggcatcggctccttcgggcgggtggtcctggtgagt
caccgggagagcggcagccactatgccatgaagatcctcaacaaggagaaggtggtgaga
ctgaaacaggtccagcacgtcctgaacgagaagcgcatcctgcaggcgatcgactttccg
ttcctcgtcaagctccatttctccttcagggacaactccaacctgtacctggtgatggag
tacgtgccgggtggggacgtgttctcccacctacagcgcgtcggaaggttcacagagccc
catgccggtttctatgccgcccagatcgtcctggccttccagtacttgcactcgctcgac
ctcatccaccgcgacctgaagcccgagaacatcgtcatcgaccagcagggctacctgcgg
gtgaccgacttcggtttcgccaagcgcgtgaggggccgcacttggaccctgtgcgggacc
ccagagtacctggcccccgagatcatcctgaacaaaggctacagcaaggccgtggactgg
tggaccctgggggtgctcatctatgagatggccgtgggcttcccgcccttctacgccgac
cagcggaattccgtcttccaaaacatcctctccgggaaggtgcggttcccctcccatgtc
agctctgacctcaagaacctgctgcggaacctgctgcaggtggacctctccaagcgcttc
gggaacctccggaacggggtcggcgacatcaagaaccacaagtggttcgccacaaccaat
tggatcgccatctatgagaaacaggtggaagctcccttcatcccgaagttcgcaggccct
ggggatgccagtaactttgacaactacgaggaggaagagatccggatctccatcaacgag
aagtatgccaacgagttttctcagttttag

DBGET integrated database retrieval system