KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392158Help
Entry
100392158         CDS       T03264                                 

Gene name
POLH
Definition
(RefSeq) DNA polymerase eta
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100392158 (POLH)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100392158 (POLH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100392158 (POLH)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100392158 (POLH)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100392158 (POLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS zf_UBZ IMS_C PRP21_like_P IMS_HHH
Motif
Other DBs
NCBI-GeneID: 100392158
NCBI-ProteinID: XP_002746624
Ensembl: ENSCJAG00000005770
UniProt: F7HZ00
Position
4
AA seq 709 aa AA seqDB search
MATGQDRVVALVDMDCFFVQVEQRQNPHLRKKPCAVVQYKSWKGGGIIAVSYEARAFGVT
RSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVD
LTSAVQERLQKLQGQPISADWLPSTYIEGLPQGPTTAEETIQKEGMRKQGLFQWLDSLQI
DNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLLSH
GSVPQLFSQMPIHKIRSLGGKLGASVTEILGIEYMGELTQFTESQLQSHFGEKNGSWLYA
MCRGIEHDPVKPRQLPKTIGCSKNFPGKTALVTREQVQWWLLQLAQELEERLTKDRNDND
RVATQLAVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFSVIKNYNTSGIQTEWSPPLT
MLFLCATKFSASAPSSCTDITSFLSSEPSCLPKVPVTSSEAKTQGSAPAVIAAKKATTSL
ESFFQKAAERQKVKEASLSSLTVSTQAPPSNSTSKPSLPFQTRQTKGTEPFFKQKSLILK
QKQLNNSSIYFPPQNPQSSSKALPNSLPTEYPGCAPICEGVLKLESSKATPAETDLAHNS
QSMHASSASKHAQEVTQKATPSLLAAEDQVPCEKCGSMVPVWEMPEHMDYHFALELQKSF
LQPHSSNPQMVSASPQGKRNPKSPLACSNKRPRPEGMQTLESFFKPLTH
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggctactggacaggatcgagtggttgctctggtggacatggactgtttttttgttcaa
gtggagcagcggcaaaatcctcatttgaggaaaaaaccttgtgcagttgtacagtacaaa
tcatggaagggtggtggaataattgcagtgagttatgaagctcgtgcatttggggtcact
agaagtatgtgggcagatgatgctaagaagttatgtccagatcttctactggcacaagtt
cgtgagtcccgtgggaaagctaacctcaccaagtaccgggaagccagtgttgaagtgatg
gagataatgtctcgttttgctgtgattgaacgtgctagcatcgatgaggcttatgtagat
ctgaccagtgctgtacaagagagactacaaaagctacaaggtcaacctatctcagcagac
tggttgccaagcacttacattgaagggttgccccaaggccctacaacggcagaagagact
attcagaaagaggggatgcgaaaacaaggcttatttcaatggcttgattcacttcagatt
gataacctcacctctccagacctgcagctcaccgtgggagcagtgattgtggaggaaatg
agagcagccatagagagagagactggttttcagtgttcagctggaatttcacacaataag
gtcctggcaaaactggcctgtggactaaacaaacccaaccgccaaaccctgctttcacat
gggtcagtcccacagctcttcagccaaatgcccattcataaaatccgtagtcttggagga
aagctaggagcctctgtcactgagatcctagggatagaatacatgggtgaattgactcag
ttcactgaatcccagctccagagtcattttggggagaagaatgggtcttggctatatgcc
atgtgccgagggattgaacatgatccagttaaacccaggcaactacccaaaaccattggc
tgtagtaagaacttcccaggaaaaacagctcttgttactcgggaacaggtacaatggtgg
ctgttgcagttagcccaggaactagaggagagactgaccaaagaccgaaatgataatgac
agggtggccacccagctggctgtaagcattcgtgtacaaggagacaaacgcctcagcagc
ctgcgccgctgctgtgcccttacccgctatgatgctcataagatgagccatgatgcattt
agtgtcatcaagaactataatacttctggaatccagacagaatggtcgcctcctctcaca
atgcttttcctctgtgctacaaaattttctgcctctgccccttcatcttgcacagacatc
accagcttcttgagcagtgaaccaagttgtctgccaaaggtgccagttaccagttcagaa
gctaagacccagggaagtgctccagcagtgatagccgctaagaaagcaaccacctctctg
gaatcattcttccaaaaagctgcagaaaggcagaaagttaaagaagcttcgctgtcatct
cttactgtgtccactcaggctcccccgagcaattcaacatccaaaccctcattacctttc
caaaccaggcaaactaaaggaactgagcccttctttaagcagaaaagtctgattctaaag
cagaaacagcttaataattcttccatatatttccctccacaaaatccacagtccagctct
aaagcattaccaaactctttaccaacagagtatccaggctgtgcgcctatttgtgaaggg
gtgttgaagctagaatcctctaaagcaactcctgcagagacggatttggcccacaacagc
caaagcatgcatgcctcttcagcttccaaacatgctcaggaggtgactcagaaagcaact
ccaagtcttctagctgctgaggatcaagtgccctgtgagaagtgtggctccatggtacca
gtatgggagatgccagaacacatggactatcattttgcattggagttgcagaaatccttt
ttgcagccccactcctcaaacccccagatggtttctgcatctcctcaaggcaaaagaaat
cctaagagccctttggcctgcagtaataaacgccccaggcctgagggcatgcagacattg
gaatcattttttaaaccattaacacactag

DBGET integrated database retrieval system