KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392193Help
Entry
100392193         CDS       T03264                                 

Gene name
ATF4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04137  Mitophagy - animal
cjc04141  Protein processing in endoplasmic reticulum
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04934  Cushing syndrome
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100392193 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100392193 (ATF4)
   04668 TNF signaling pathway
    100392193 (ATF4)
   04022 cGMP-PKG signaling pathway
    100392193 (ATF4)
   04151 PI3K-Akt signaling pathway
    100392193 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100392193 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100392193 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100392193 (ATF4)
   04922 Glucagon signaling pathway
    100392193 (ATF4)
   04912 GnRH signaling pathway
    100392193 (ATF4)
   04915 Estrogen signaling pathway
    100392193 (ATF4)
   04926 Relaxin signaling pathway
    100392193 (ATF4)
   04918 Thyroid hormone synthesis
    100392193 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100392193 (ATF4)
   04925 Aldosterone synthesis and secretion
    100392193 (ATF4)
   04927 Cortisol synthesis and secretion
    100392193 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100392193 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100392193 (ATF4)
   04728 Dopaminergic synapse
    100392193 (ATF4)
   04720 Long-term potentiation
    100392193 (ATF4)
   04722 Neurotrophin signaling pathway
    100392193 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100392193 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100392193 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100392193 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100392193 (ATF4)
   05031 Amphetamine addiction
    100392193 (ATF4)
   05034 Alcoholism
    100392193 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100392193 (ATF4)
   04934 Cushing syndrome
    100392193 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392193 (ATF4)
   05161 Hepatitis B
    100392193 (ATF4)
   05163 Human cytomegalovirus infection
    100392193 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100392193 (ATF4)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100392193 (ATF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Fez1 Nop53 Laminin_II AAA_13 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 100392193
NCBI-ProteinID: XP_002763954
Ensembl: ENSCJAG00000002594
UniProt: H9KVU9
Position
Un
AA seq 351 aa AA seqDB search
MTEMSFLSSEVLEGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSAPNNGKEDAFSGTDWMLEKMDLKEFDFDSLLATDDLETMTDELLATLDDTC
DLFAPLVQETNKEPPQAVNPIGHLPESLTKPDQVAPFTFLEPLPLSPGVLSTTPDHSFSL
ELGSEVGISEGDTKSDSTAYIAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSARG
SPNRSLTSPGVLCDSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatgagtttcctgagcagcgaggtgttggagggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggaaagcctaggtctcttagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcccccaacaacggcaaggaggatgctttctcc
gggacagattggatgttggagaaaatggatctgaaagagtttgactttgattccctgttg
gctacagatgacctggaaaccatgacagatgagcttttggccacgttagatgacacatgt
gacctctttgccccgctagtccaggagactaataaggagcccccccaggcggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccctttcaccttcttg
gaacctcttcccctatcccccggggtcctctccaccactccagatcattcctttagttta
gaactgggcagtgaagtaggtatctctgaaggagatacgaagtcagactccactgcttac
atagccatgatcccgcagtgcataaaggaggaagacaccccctcagataatgatagtggc
atctgtatgagcccagagtcctatttgggctccccccagcatagcccctctgccaggggc
tccccaaataggagcctcacatctccaggtgtcctctgtgactctgcccgtcccaaacct
tacgaccctcctggagagaaaatggtagcagcaaaagtaaagggtgagaaactggataag
aaactgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggtgagtgtaaggagctggaaaagaagaacgaagctcta
aaagagagggcagattccttggccaaggagatccaatacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392579Help
Entry
100392579         CDS       T03264                                 

Gene name
CREB5
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100392579 (CREB5)
   04024 cAMP signaling pathway
    100392579 (CREB5)
   04022 cGMP-PKG signaling pathway
    100392579 (CREB5)
   04151 PI3K-Akt signaling pathway
    100392579 (CREB5)
   04152 AMPK signaling pathway
    100392579 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100392579 (CREB5)
   04922 Glucagon signaling pathway
    100392579 (CREB5)
   04915 Estrogen signaling pathway
    100392579 (CREB5)
   04926 Relaxin signaling pathway
    100392579 (CREB5)
   04918 Thyroid hormone synthesis
    100392579 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    100392579 (CREB5)
   04925 Aldosterone synthesis and secretion
    100392579 (CREB5)
   04927 Cortisol synthesis and secretion
    100392579 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100392579 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100392579 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    100392579 (CREB5)
   04728 Dopaminergic synapse
    100392579 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    100392579 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100392579 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100392579 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    100392579 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100392579 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    100392579 (CREB5)
   05031 Amphetamine addiction
    100392579 (CREB5)
   05034 Alcoholism
    100392579 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100392579 (CREB5)
   04934 Cushing syndrome
    100392579 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392579 (CREB5)
   05161 Hepatitis B
    100392579 (CREB5)
   05163 Human cytomegalovirus infection
    100392579 (CREB5)
   05165 Human papillomavirus infection
    100392579 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100392579 (CREB5)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100392579 (CREB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 GIT_CC DivIC
Motif
Other DBs
NCBI-GeneID: 100392579
NCBI-ProteinID: XP_002751487
Ensembl: ENSCJAG00000008344
UniProt: F7GZV5
Position
8
AA seq 508 aa AA seqDB search
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMDMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTSNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaggagaggccgtttgtctgcagtgcc
ccaggctgctcccagcgcttcccaacagaggaccatctgatgattcacaggcacaagcat
gaaatgactttgaagtttccttcaataaaaacagacaacatgttatcagatcaaactccg
accccaacgagattcctgaagaactgcgaggaggtgggcctctttagcgagctggactgc
tctctggagcacgagttcaggaaggcccaggaggaggagagcagtaagcggaatatctcg
atgcataatgcagttggtggggccatgacggggcccggaactcaccagcttagcagcgct
cggctgcccaaccacgacaccagcgttgtgattcagcaagccatgccgtcaccccagtcc
agctccgtcatcactcaggcaccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatgccc
gggaccctgcccaaccctacaatgccaggatcttccgccgtcttgatgccaatggagaga
caaatgtcagtgaactccagcatcatggggatgcaaggtccaaatctcagcaacccctgt
gcttctccccaagtccagccaatgcattcagaagccaaaatgaggttgaaggctgcattg
actcaccaccctgctgccatgtcaaatgggaatatgaacaccatgggacacatgatggac
atgatgggctcccggcaggaccagacgccacaccatcacatgcactcacacccgcatcag
caccagacactgccaccccaccacccttacccacaccagcaccagcacccagcgcaccat
cctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccacctt
catgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccagtaaccaa
gcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccgccccag
cccacaggggggcgccggcgaagggtggtggacgaggatcccgacgagaggcgacggaaa
tttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgggtg
atgtcactggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaatgaa
gtgtctatgttgaaaaacgaggtggcccagctgaaacagttgttgttaacacacaaagac
tgcccgataacagccatgcagaaggaatcgcaaggatatctaagtccggagagtagccct
cctgcaagtcctgtcccagcttgctcccagcaacaagtcatccagcataataccatcact
acttcctcatcggtcagcgaggtggtaggaagctccaccctcagccagctcaccactcac
agaacagacctgaacccgattctttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394351Help
Entry
100394351         CDS       T03264                                 

Gene name
CREB3L3
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100394351 (CREB3L3)
   04024 cAMP signaling pathway
    100394351 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    100394351 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    100394351 (CREB3L3)
   04152 AMPK signaling pathway
    100394351 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100394351 (CREB3L3)
   04922 Glucagon signaling pathway
    100394351 (CREB3L3)
   04915 Estrogen signaling pathway
    100394351 (CREB3L3)
   04926 Relaxin signaling pathway
    100394351 (CREB3L3)
   04918 Thyroid hormone synthesis
    100394351 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    100394351 (CREB3L3)
   04916 Melanogenesis
    100394351 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    100394351 (CREB3L3)
   04927 Cortisol synthesis and secretion
    100394351 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100394351 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100394351 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    100394351 (CREB3L3)
   04728 Dopaminergic synapse
    100394351 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    100394351 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100394351 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100394351 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100394351 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100394351 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    100394351 (CREB3L3)
   05031 Amphetamine addiction
    100394351 (CREB3L3)
   05034 Alcoholism
    100394351 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100394351 (CREB3L3)
   04934 Cushing syndrome
    100394351 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100394351 (CREB3L3)
   05161 Hepatitis B
    100394351 (CREB3L3)
   05163 Human cytomegalovirus infection
    100394351 (CREB3L3)
   05165 Human papillomavirus infection
    100394351 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100394351 (CREB3L3)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100394351 (CREB3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf SOGA KASH_CCD ZapB DUF2207 Ax_dynein_light ADIP
Motif
Other DBs
NCBI-GeneID: 100394351
NCBI-ProteinID: XP_017823687
Ensembl: ENSCJAG00000015105
Position
22
AA seq 467 aa AA seqDB search
MELDGPMNENLAAGKMASAACPMDPIDSFELLDLLFDRQDGILRHVDLGEGWGRVEDQQV
LPNPDGDDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPPDTPPRVGPAASPVGCH
PAQPGKGPCLSYHPGTSCPTTPPGPVVQLPEASVTIDLEMWSPGGRISAEKQAEPVGLSP
RHNLTVKDLLLSGSSGDLQQRHLGAPHLLRPVAGHCQELVLTEDEKKLLVKEGITLPVQM
PLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVVHLEK
QNLSLLEQLKKLQAIVVQSTSKSAQTGTCIAVLLLSFALIILPSISPFASNKVKSPGDFA
PVRVFSRTLHNDAASRVAPDALLGSEAPGPRPEAEKPKEGSPGSPRAAWGFQDTVHLTNS
MEELDNASLVLRNETEGLGEVAQLDWVAPGPSTGSGHAGLEAVGEEL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggaactggatgggcccatgaatgagaatttagctgcaggaaagatggcttctgctgcc
tgccccatggaccccatcgacagctttgagctcctggatctcctgtttgataggcaggac
ggaatcctgagacatgtggatctgggcgagggctggggccgcgtcgaagaccagcaggtc
ctgccaaaccccgacggtgatgacttcctcagctccatcctgggctccggagactcactg
cccagctccccactctggtcccctgaaggcagcgacagtggcatctctgaagacctccca
tccgaccccccagacacccctccacgcgtcggaccagccgcctccccagttggctgccat
cccgcccagcccggcaagggcccctgcctctcttatcatcccggcacctcctgtcccacc
acacccccggggccagtggtccaactgcccgaagcctctgtgaccatagacctggaaatg
tggagcccgggaggaaggatctctgctgagaagcaggctgaaccggtgggcctgtcacca
cggcacaatctcacggtgaaagatctgctgctttcgggcagcagcggcgacctgcaacag
cgtcacctgggagccccccacctgctgcgacctgtggccgggcactgccaggagctggtg
ctgaccgaggatgagaagaagctgctggtgaaggaaggcatcaccctgccggtccagatg
ccactcactaagtatgaggagcgagtgctgaaaaaaatccgccgaaaaatccggaacaag
cagtccgcccaagaaagcaggaagaagaagaaggaatacattgacggcttggagactcgg
atgtcagcttgcactgctcagaatcaggagttacagaggaaggtcgtgcatctggagaag
caaaatctgtccctcttggagcagctgaagaaactccaggccatcgtggtgcagtccacc
agcaagtcagcccagacagggacctgcatcgcagtcctgttactgtccttcgccctcatc
atcctcccctccatcagcccttttgcctccaacaaagtcaagagccctggggactttgca
cctgtgcgagtcttctccagaactttgcacaatgatgctgcctcccgcgtggcccctgat
gctctgctgggctctgaggcccccggaccccgaccagaggctgagaaacccaaagaaggg
tctccaggcagccccagggcagcctggggcttccaggacaccgtgcacctgaccaattcg
atggaggagctggacaatgccagcctggtcctgaggaacgagacggaggggctgggcgag
gttgcccagctagactgggtggcacctgggccaagtactggntcaggacatgcagggctt
gaggcggtgggggaagagctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406635Help
Entry
100406635         CDS       T03264                                 

Gene name
CREB3L1
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100406635 (CREB3L1)
   04024 cAMP signaling pathway
    100406635 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    100406635 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    100406635 (CREB3L1)
   04152 AMPK signaling pathway
    100406635 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100406635 (CREB3L1)
   04922 Glucagon signaling pathway
    100406635 (CREB3L1)
   04915 Estrogen signaling pathway
    100406635 (CREB3L1)
   04926 Relaxin signaling pathway
    100406635 (CREB3L1)
   04918 Thyroid hormone synthesis
    100406635 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    100406635 (CREB3L1)
   04916 Melanogenesis
    100406635 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    100406635 (CREB3L1)
   04927 Cortisol synthesis and secretion
    100406635 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100406635 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100406635 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    100406635 (CREB3L1)
   04728 Dopaminergic synapse
    100406635 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    100406635 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100406635 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100406635 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100406635 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100406635 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    100406635 (CREB3L1)
   05031 Amphetamine addiction
    100406635 (CREB3L1)
   05034 Alcoholism
    100406635 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100406635 (CREB3L1)
   04934 Cushing syndrome
    100406635 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100406635 (CREB3L1)
   05161 Hepatitis B
    100406635 (CREB3L1)
   05163 Human cytomegalovirus infection
    100406635 (CREB3L1)
   05165 Human papillomavirus infection
    100406635 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100406635 (CREB3L1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100406635 (CREB3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 HAUS-augmin3 JMY APG6_N TPR_MLP1_2 Jnk-SapK_ap_N DUF3552 DUF4404 ADIP
Motif
Other DBs
NCBI-GeneID: 100406635
NCBI-ProteinID: XP_002755259
Ensembl: ENSCJAG00000011726
Position
11
AA seq 519 aa AA seqDB search
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNEHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAAATMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPPEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKKDPMAADSVYTASQM
PSRSLLFYDDGAGSWEDGRSTLLPMEPPDGWEINPGGPAEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDAGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtcttggaacccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggacttcctcaacaatgagcactttcctgagcacctg
gaccactttgcggagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggatgagaagagccctctattggatatggaactagactccccaacgcca
ggcatccaggcggagcacagctactccctgagcggagactcagcgccccagagccccctg
gtgcccatcaagatggaggacaccacccaagatgtggagcatggagcatgggcgctggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgccccctctgccatggctgccgcggccaccatggccaccaccccgctgctgggt
ctcagccccctgtccaggctgcccatcccccaccaggccccgggagagatgactcagctg
ccagtgatcaaggcagagcctccggaggtgaaccagttcctcaaagtgacaccagaggac
ctggtgcagatgcctccgacgccccccagcagccacggcagcgacagcgacggctcccag
agtccccgttctctgcccccttccagccctgtccggcctatggcgcgctcctccacagcc
atctccacctccccactcctcactgccccgcacaaactacaggggacttcagggccactg
ctcctgactgaggaggagaagcgaaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagctgaggagaaggccttgaagagagtccggaggaaaatcaagaac
aagatctcagcccaggagagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggagacatttacatcagagaacaatgaactgtggaagaaggtggagaccctggaa
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggcggccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctcccttgtgccctgccttcccgagttctcctccggc
tcccagactgtgaagaaagaccccatggccgcagacagcgtctacacggccagccagatg
ccctcccgaagcctcctgttctacgatgatggggcgggctcgtgggaagatggccgcagc
accctgctgccaatggaacccccagatggctgggaaatcaaccctggggggccggcggag
cagcggccccaggaccacctgcagcatgatcacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggcccaaagatgctggaaacggcaccagccccgacttctcccac
tccaaggagtggttccacgacagggatctgggccccaacaccaccatcaaactctcctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407681Help
Entry
100407681         CDS       T03264                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04380  Osteoclast differentiation
cjc04612  Antigen processing and presentation
cjc04668  TNF signaling pathway
cjc04710  Circadian rhythm
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100407681 (CREB1)
   04024 cAMP signaling pathway
    100407681 (CREB1)
   04022 cGMP-PKG signaling pathway
    100407681 (CREB1)
   04151 PI3K-Akt signaling pathway
    100407681 (CREB1)
   04152 AMPK signaling pathway
    100407681 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100407681 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    100407681 (CREB1)
   04922 Glucagon signaling pathway
    100407681 (CREB1)
   04915 Estrogen signaling pathway
    100407681 (CREB1)
   04926 Relaxin signaling pathway
    100407681 (CREB1)
   04918 Thyroid hormone synthesis
    100407681 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100407681 (CREB1)
   04916 Melanogenesis
    100407681 (CREB1)
   04924 Renin secretion
    100407681 (CREB1)
   04925 Aldosterone synthesis and secretion
    100407681 (CREB1)
   04927 Cortisol synthesis and secretion
    100407681 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100407681 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100407681 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    100407681 (CREB1)
   04728 Dopaminergic synapse
    100407681 (CREB1)
  09158 Development
   04380 Osteoclast differentiation
    100407681 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    100407681 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100407681 (CREB1)
   04713 Circadian entrainment
    100407681 (CREB1)
   04714 Thermogenesis
    100407681 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100407681 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100407681 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100407681 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100407681 (CREB1)
   05031 Amphetamine addiction
    100407681 (CREB1)
   05034 Alcoholism
    100407681 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100407681 (CREB1)
   04934 Cushing syndrome
    100407681 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100407681 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100407681 (CREB1)
   05161 Hepatitis B
    100407681 (CREB1)
   05163 Human cytomegalovirus infection
    100407681 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100407681 (CREB1)
   05165 Human papillomavirus infection
    100407681 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100407681 (CREB1)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100407681 (CREB1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100407681 (CREB1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100407681 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf Rh5 DUF5570
Motif
Other DBs
NCBI-GeneID: 100407681
NCBI-ProteinID: XP_008997586
Ensembl: ENSCJAG00000006039
UniProt: F7HRM8
Position
6
AA seq 341 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQTAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacgttagcccaggtgtct
atgccagcagctcatgcaacatcatctgctcctaccgtaactctagtacagctgcctaat
gggcagacagttcaagtccatggagttattcagacggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggaatcagtggatagcgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccagactagcagtgga
cagtacattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcaaacgttaaccatgaccaatgcagctgccactcagccgggtactacc
attctacagtatgcacagacaactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagacgtacaaacataccagattcgcacagcacccactagc
actattgctcctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408954Help
Entry
100408954         CDS       T03264                                 

Gene name
CREB3
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100408954 (CREB3)
   04024 cAMP signaling pathway
    100408954 (CREB3)
   04022 cGMP-PKG signaling pathway
    100408954 (CREB3)
   04151 PI3K-Akt signaling pathway
    100408954 (CREB3)
   04152 AMPK signaling pathway
    100408954 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100408954 (CREB3)
   04922 Glucagon signaling pathway
    100408954 (CREB3)
   04915 Estrogen signaling pathway
    100408954 (CREB3)
   04926 Relaxin signaling pathway
    100408954 (CREB3)
   04918 Thyroid hormone synthesis
    100408954 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100408954 (CREB3)
   04916 Melanogenesis
    100408954 (CREB3)
   04925 Aldosterone synthesis and secretion
    100408954 (CREB3)
   04927 Cortisol synthesis and secretion
    100408954 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100408954 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100408954 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    100408954 (CREB3)
   04728 Dopaminergic synapse
    100408954 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    100408954 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100408954 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100408954 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100408954 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100408954 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    100408954 (CREB3)
   05031 Amphetamine addiction
    100408954 (CREB3)
   05034 Alcoholism
    100408954 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100408954 (CREB3)
   04934 Cushing syndrome
    100408954 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100408954 (CREB3)
   05161 Hepatitis B
    100408954 (CREB3)
   05163 Human cytomegalovirus infection
    100408954 (CREB3)
   05165 Human papillomavirus infection
    100408954 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100408954 (CREB3)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100408954 (CREB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 100408954
NCBI-ProteinID: XP_017830081
Ensembl: ENSCJAG00000009873
Position
1
AA seq 373 aa AA seqDB search
MSQMELELDPGDEDLLGFLLEASGDLGTAHEAIRAPLDWELLLSEVPSDWELDDLLSSLL
SPPASLNVLSSSNPCLVHHDHTYSLPQEAVSVDLESESFGKEETQMTTQHVEEMAEQETV
RLVLTDEEKSLLEKEGLILPETLPLTKMEEQILKRVRRKIRNKRSAQESRMKKNVYVGGL
ESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIAISNKTSSSSTCVLVLLFSF
CLLLVPAMYSSDTRESLPAEHGVLFRQLRALPSEDPYQLELSTLQSEVLKDSTHQWLDGS
DHVLQVPGNSSCLLHYMSQALRAERPLEWLFPDLFSEPLCRDPILLLQANLTRKGVRLST
YSPSVILQDRYSG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaatggagctagaattggatcctggtgacgaagacctgctgggcttcctgcta
gaggcaagtggagatttggggacggcgcacgaggccatcagggccccactggactgggag
ctgctgctttctgaggtaccgagtgactgggagttagatgatttgctgagctcactgctg
agtcccccagcatcgttgaacgttctcagctcctccaacccctgccttgtccaccacgac
cacacctactccctcccacaggaagctgtctctgttgatctagagagtgagagctttgga
aaagaggagacccagatgactacacagcatgtggaggaaatggcagagcaggagactgtt
aggttggtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcct
gagacacttcctctcactaagatggaggaacaaattctgaaacgtgtgcgaaggaagatt
cgaaataaaagatctgctcaagagagccgcatgaagaagaacgtgtatgttgggggttta
gagagcagggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacagctt
ctggaggaacagaatttgtcccttctagatcaactgaggaaactccaggccatggtgatt
gcgatatcaaacaaaaccagtagcagcagcacctgtgtcttggtcctgctattctccttc
tgcctcctccttgtacctgctatgtactcctctgacacaagagagagcctgccagctgag
catggagtgttgttccgccagcttcgtgccctccccagtgaggacccttaccagctggag
ctgtctaccctgcagtcagaggtgctgaaagacagcacacaccagtggctggacggctca
gaccatgtactccaggtccctggcaactcttcctgcctgctacactacatgtctcaggct
ctcagggcagagcgtcccctggagtggctattccctgacctcttctcagagcctctctgc
cgagatcccatcctccttctgcaggcaaatctcacaagaaagggggtaaggctttctacc
tatagcccctctgtcatcctgcaggacagatactcaggctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409637Help
Entry
100409637         CDS       T03264                                 

Gene name
CREB3L2
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100409637 (CREB3L2)
   04024 cAMP signaling pathway
    100409637 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    100409637 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    100409637 (CREB3L2)
   04152 AMPK signaling pathway
    100409637 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100409637 (CREB3L2)
   04922 Glucagon signaling pathway
    100409637 (CREB3L2)
   04915 Estrogen signaling pathway
    100409637 (CREB3L2)
   04926 Relaxin signaling pathway
    100409637 (CREB3L2)
   04918 Thyroid hormone synthesis
    100409637 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    100409637 (CREB3L2)
   04916 Melanogenesis
    100409637 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    100409637 (CREB3L2)
   04927 Cortisol synthesis and secretion
    100409637 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100409637 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100409637 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    100409637 (CREB3L2)
   04728 Dopaminergic synapse
    100409637 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    100409637 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100409637 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100409637 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100409637 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100409637 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    100409637 (CREB3L2)
   05031 Amphetamine addiction
    100409637 (CREB3L2)
   05034 Alcoholism
    100409637 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100409637 (CREB3L2)
   04934 Cushing syndrome
    100409637 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100409637 (CREB3L2)
   05161 Hepatitis B
    100409637 (CREB3L2)
   05163 Human cytomegalovirus infection
    100409637 (CREB3L2)
   05165 Human papillomavirus infection
    100409637 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100409637 (CREB3L2)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100409637 (CREB3L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Motif
Other DBs
NCBI-GeneID: 100409637
NCBI-ProteinID: XP_002751992
Ensembl: ENSCJAG00000012834
UniProt: F7I3W1
Position
8
AA seq 520 aa AA seqDB search
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEARAQSPFTHVTTSDSFNDDEVESEKWYLSTDF
PSATIKTEPITDEPPPGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPCPHPFSLPQTHSPSRTTP
RGPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEEPSSPGSAGELGGWDRSSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgtgctccagtgggaccgcaagctgagcgag
ttgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgaccctttcctctcagagaag
agtgtgtcaatggaggtggaaccttccccgacgtccccagcgcctctcatccaggctgag
cacagctactccctgtgcgaggaggctcgggcccagtcgccgttcacccacgttaccacc
agtgacagcttcaatgatgacgaggtggaaagtgagaagtggtacctgtctacagacttc
ccttcagcaaccatcaagacagagcccattacagatgaaccaccccccggactcgttcca
tctgtcactctgaccatcacagccatctccaccccgtttgaaaaggaggaaccccctctg
gaaatgaatactggggttgattcctcgtgccagaccatcattcctaaaattaagctggag
cctcacgaagtggatcagtttctaaacttctctcctaaagaagccccagtggatcacctg
catttgccgcccacccccccaagcagtcacggcagcgactcggaaggcagcctgagtccc
aacccatgcccgcaccccttcagcctgcctcaaacccacagcccctccagaaccacaccc
cggggcccctctgccctctccagctcccctctcctcacggctcctcataaactgcaggga
tcaggccctctggtcctgacagaggaggagaagaggaccctgattgctgagggctatccc
atccctaccaaattgcccctgacaaaatcagaggagaaggccctgaagaaaattcggagg
aagatcaagaataagatttctgcccaggagagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggaatcttgttcaactgagaacttggaacttcggaagaaggta
gaggttctagagaacactaacaggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagctggcacgcagactggcacctgcctc
atggttgttgtgctgtgctttgccgttgcatttggcagcttctttcagggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattccctgcaagagccctacaca
gcctccgtggtgagatccaggaacctgctgatctacgaggaacattctcccccagaggag
ccgtccagccctggctctgctggcgagctggggggctgggatagaagttcctccctgctc
agggtgtcagggctggagtccaggccggatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgctcttggagctgcagcagcacctggtcagcgccaaa
ctggaggggaatgaaaccctaaaagttgtagaactcgacagaagagtgaacaccactttc
taa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411140Help
Entry
100411140         CDS       T03264                                 

Gene name
CREB3L4
Definition
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04931  Insulin resistance
cjc04934  Cushing syndrome
cjc04962  Vasopressin-regulated water reabsorption
cjc05016  Huntington disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100411140 (CREB3L4)
   04024 cAMP signaling pathway
    100411140 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    100411140 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    100411140 (CREB3L4)
   04152 AMPK signaling pathway
    100411140 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100411140 (CREB3L4)
   04922 Glucagon signaling pathway
    100411140 (CREB3L4)
   04915 Estrogen signaling pathway
    100411140 (CREB3L4)
   04926 Relaxin signaling pathway
    100411140 (CREB3L4)
   04918 Thyroid hormone synthesis
    100411140 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    100411140 (CREB3L4)
   04916 Melanogenesis
    100411140 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    100411140 (CREB3L4)
   04927 Cortisol synthesis and secretion
    100411140 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100411140 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100411140 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    100411140 (CREB3L4)
   04728 Dopaminergic synapse
    100411140 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    100411140 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    100411140 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100411140 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100411140 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100411140 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    100411140 (CREB3L4)
   05031 Amphetamine addiction
    100411140 (CREB3L4)
   05034 Alcoholism
    100411140 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100411140 (CREB3L4)
   04934 Cushing syndrome
    100411140 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100411140 (CREB3L4)
   05161 Hepatitis B
    100411140 (CREB3L4)
   05163 Human cytomegalovirus infection
    100411140 (CREB3L4)
   05165 Human papillomavirus infection
    100411140 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100411140 (CREB3L4)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100411140 (CREB3L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 ATG16 APG6_N HAUS-augmin3 KASH_CCD HALZ JMY DUF1664 YabA MCU Jnk-SapK_ap_N
Motif
Other DBs
NCBI-GeneID: 100411140
NCBI-ProteinID: XP_008982698
Ensembl: ENSCJAG00000009978
UniProt: F7D041
Position
18
AA seq 394 aa AA seqDB search
MDLGIPDLLDTWLEPPEDIFSTGSVLELGLHCPAPEVPVTRLQEQGLQGWKSSGDHGCGL
PESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCRPDSPPAPRATSSPAVYEVVYEAG
ALERMQEGAGPNVGFISIQLDQWSPAFMVPDACMVSELPFDAHAHILPRAGTVAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LFSLALIILPSFSPFQGRPEAGPEDYQPHGVTSRNILTHKDITENLETQVVESRLREPPG
AKDANGSTRTLLEKMGGKPRPSGRIRNVLHADEM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatctcggaatccctgacctgctggacacgtggctggagcccccagaggatatcttt
tcaacaggatccgtcctggagctgggactccactgccctgctccagaggttccagtgact
aggctacaggaacaaggattgcaaggctggaagtccagtggggaccatggctgtggcctt
ccagagagtgagcctgaagatttcctgaagctcttcattgatcccaatgaagtgtactgc
tcggaagcatctcctggcagtgacagtggcatctctgaggacccctgccgtccagacagt
cctcctgcccccagggcaaccagttctcctgccgtctatgaggttgtctatgaggcaggg
gctctggagaggatgcaggagggagctgggccaaatgtaggcttcatctccatccagcta
gatcagtggagcccagcatttatggtgcctgatgcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcctgcccagagcaggcaccgtagccccagtgccttgtacaacc
ctgctgccctgtcaaaccctgttcctgacagatgaggagaagcgtctgctggggcaagaa
ggggtttctctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcggctcaggacagtcggcggcggaagaaggag
tacattgatggtctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaacatctccttggtagctcagctccgccagctg
cagacgctaattgctcaaacttccaacaaagctgctcagaccagcacttgtgttctgatt
cttttttccctggctctcatcatcctgcctagcttcagtccattccagggtcgaccagaa
gctgggcctgaggattaccagcctcatggagtgacttccagaaatatcctgacccacaag
gacataacagaaaatctggagacccaagtggtagagtccagactgagggagccacctgga
gccaaggatgcaaatggctcaacgaggacactgcttgagaagatgggagggaagccaaga
cccagtgggcgcatcaggaacgtgctgcatgcagatgagatgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411862Help
Entry
100411862         CDS       T03264                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04151  PI3K-Akt signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100411862 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100411862 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100411862 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100411862 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100411862 (ATF6B)
   04915 Estrogen signaling pathway
    100411862 (ATF6B)
   04926 Relaxin signaling pathway
    100411862 (ATF6B)
   04918 Thyroid hormone synthesis
    100411862 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100411862 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100411862 (ATF6B)
   04927 Cortisol synthesis and secretion
    100411862 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100411862 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100411862 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100411862 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100411862 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100411862 (ATF6B)
   05031 Amphetamine addiction
    100411862 (ATF6B)
   05034 Alcoholism
    100411862 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100411862 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100411862 (ATF6B)
   05161 Hepatitis B
    100411862 (ATF6B)
   05163 Human cytomegalovirus infection
    100411862 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100411862 (ATF6B)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100411862 (ATF6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA
Motif
Other DBs
NCBI-GeneID: 100411862
NCBI-ProteinID: XP_008992441
Ensembl: ENSCJAG00000036009
Position
4
AA seq 708 aa AA seqDB search
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPS
SQALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVGLTSDDSSDVHTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESPSPSGCLLWDIPAPSLGAVQISMGPSPDGS
SGKALPTRKPPLQPKPVVLTTIPMPPRTVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPISARVNKGEPRPRRHLLEFSGPVHRVEPLQGSSHSPEEPQPSPEDQPRF
RNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRA
QERQKSQPRKSSPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagtgagattgcagac
ccgacgcgtttcttcaccgacaacctgctgagcccggaggactggggtctgcggaacagc
accttgtattctggcctagatgaagtggccgaggaacagacgcagctcttccgttgcccg
gagcaggatgtcccgtttgacggcagttccctggacgtggggatggatgtcagcccccct
gagcccccgtgggaactcctgcccatctttccagatcttcaggtgaagtctgagccatct
tccccctgctcgtcctcctccctcagctcggaatcatcacatctctccacagagccctcc
agccaggctcttggggtaggagaggtgctccatgtgaagacagagtccttggcaccccca
ctctgtctcctgggagatgacccaacatcctcgtttgaaaccgtccagatcaatgtaggc
ctcacctctgatgattcctcagatgtccataccaagatagaacctgtctctccatgttcc
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccccatctccttcagggtgtcttctgtgggat
atcccagccccatcacttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcagggaaagccttgcccacccggaagccgccactgcagcccaaacctgtggtgctaacc
accatcccaatgccacccagaactgtgcctcccagcaccactgttcttctgcagcctctc
gtccagccacccccagtgtccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccagctccctctcttccacggcctgagaggaagagcattgttcctgctcctatg
cctggaaactcctgccctcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaacagggagtcagcctgccagtcccggagaaagaagaaagagtatttgcagggg
ctggaggctcggctgcaggcggtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttaggatcg
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcatcgccttcaactttgga
cctgtcagcatcagtgagcctccttcagctcccatctctgctcgggtgaacaagggggag
cctcgcccccggagacacttgctggagttctcagggccagttcacagagttgaacctctc
caggggtcctcccatagccctgaggagccccagcctagccccgaagaccagcccagattc
aggaacctgacagccttccctgggggcgccaaggagctactactgagagacctagaccag
ctcttcctctcctctgattgccggcatttcaaccgaaccgagtccctgaggcttgctgac
gagttgagtggctgggtccagcgccaccagagaggccggcggaagatccctcagagggcc
caggagagacagaagtctcagccacggaagtcatctccagttaaggcagtccccatccaa
ccccctggacccccagaaagggattctgtgggccaactgcagctatatcgccacccagac
cgttcacagccagcgttcttggatgcaattgaccgacgggaagacacattctatgttgtc
tctttccgaagggatcacctgctgctcccagccatcagccacaacaagacctcccggccc
aagatgtctctggtgatgcctgctatggcccccaatgagaccttgtcaggccgtggggcc
ccgggggactatgaggagatgatgcagatcgaatgtgaggtcatggacaccagggtgatt
cacatcaagacctccacggtgcccccctcgctccgaaaacagccatcccccaccccaggc
aatgccacaggtggccccttgccagcctctgcagccagccaggcccaccaggcctctcac
cagcccctctacctcaatcatccctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414156Help
Entry
100414156         CDS       T03264                                 

Gene name
ATF2
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100414156 (ATF2)
   04668 TNF signaling pathway
    100414156 (ATF2)
   04022 cGMP-PKG signaling pathway
    100414156 (ATF2)
   04151 PI3K-Akt signaling pathway
    100414156 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100414156 (ATF2)
   04922 Glucagon signaling pathway
    100414156 (ATF2)
   04915 Estrogen signaling pathway
    100414156 (ATF2)
   04926 Relaxin signaling pathway
    100414156 (ATF2)
   04918 Thyroid hormone synthesis
    100414156 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    100414156 (ATF2)
   04925 Aldosterone synthesis and secretion
    100414156 (ATF2)
   04927 Cortisol synthesis and secretion
    100414156 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100414156 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100414156 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    100414156 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100414156 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100414156 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    100414156 (ATF2)
   05031 Amphetamine addiction
    100414156 (ATF2)
   05034 Alcoholism
    100414156 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100414156 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100414156 (ATF2)
   05161 Hepatitis B
    100414156 (ATF2)
   05163 Human cytomegalovirus infection
    100414156 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100414156 (ATF2)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100414156 (ATF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Motif
Other DBs
NCBI-GeneID: 100414156
NCBI-ProteinID: XP_008996919
Ensembl: ENSCJAG00000008085
Position
6
AA seq 506 aa AA seqDB search
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQHSPQEVD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcgcctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccgtttgagaatgaattcaagaaagcttca
gaagatgacattaaaaaaatgcctctagatttatcccctcttgcaacacctatcataaga
agcaaaattgaggagccttctgttgtggaaacaactcaccaggatagtcctttacctcat
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgctaacaagttctgac
tcaagtgtcattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccactcgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcgtctccccaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagt
ggattggttaggactcagtcagaggaatctcgaccacagtcattacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaagtacaagt
ggtcgtcggagaagagcagctaatgaagatcctgatgaaaaaaggagaaagttcttagag
cgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttctttaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
actgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
atttcagtgccgagcagtccacacacagaagctatacaacatagttcggtcagcacatcc
aatggagtcagttcaacctccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcacagatcgttatggctccttcctcccagcac
agccctcaggaagttgattaa

DBGET integrated database retrieval system