KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392303Help
Entry
100392303         CDS       T03264                                 

Gene name
AOC2
Definition
(RefSeq) retina-specific copper amine oxidase
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00260  Glycine, serine and threonine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100392303 (AOC2)
   00350 Tyrosine metabolism
    100392303 (AOC2)
   00360 Phenylalanine metabolism
    100392303 (AOC2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100392303 (AOC2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     100392303 (AOC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid NPR1_interact bMG6
Motif
Other DBs
NCBI-GeneID: 100392303
NCBI-ProteinID: XP_017827859
Position
5
AA seq 273 aa AA seqDB search
MLSASCHTSAVDIMEKTGIWPRDFTWYGTHLPSFTLAGLKNWVIAEDVVFKPVAAPWNPE
HWLQRPQLTRQVLGKEDLAAFSLGSPLPRYLYLASNQTNAWSHQRGYRIQIHSPLGVHMP
LESDMERALSWGRYQLVVTQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGESSSS
SIFLQDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFLLQPYNFFDEDPSIFSPASVYFER
GQNSGLCSVNSVACLPDLAACVPDLPPFSYHGF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgctctctgcctcttgtcacaccagtgcagtggacatcatggaaaagacaggaatctgg
cccagagactttacctggtatggaactcatcttccttccttcaccctggcagggctgaaa
aactgggtgatagctgaagacgtggtgtttaaacctgtggctgccccctggaacccagag
cactggctacagcgcccacagctgactcggcaggtcctgggaaaggaggacctggcagct
ttttccttgggaagtcccctaccccgctacctctacctggctagcaaccagactaatgcc
tggagtcaccagcgtgggtaccgaatccagatccacagtccccttggcgtacacatgccc
ctggagagtgacatggagagggccctcagctgggggagataccagcttgtggtgacccag
agaaaggaggaggagtcacagagcagtagcatctatcaccagaatgacatctggacaccc
acagttacctttgctgacttcatcaacaatgaaaccctcttaggagagtcctccagctcc
tccatcttcctgcaggatctggtggcttgggtcacagccagcttcctgcacattccccat
gccgaggacatccccaacacagtgactctggggaacagagttggcttcttgctccaacct
tataacttctttgatgaggacccctccatcttctcccctgccagcgtctactttgagagg
ggccagaactctggcctctgcagcgtcaattccgtggcctgcctccctgacctagcagcc
tgtgtcccagacttgccccctttctcctaccatggtttctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392670Help
Entry
100392670         CDS       T03264                                 

Definition
(RefSeq) membrane primary amine oxidase-like
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00260  Glycine, serine and threonine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100392670
   00350 Tyrosine metabolism
    100392670
   00360 Phenylalanine metabolism
    100392670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100392670
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     100392670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2 DUF1965
Motif
Other DBs
NCBI-GeneID: 100392670
NCBI-ProteinID: XP_008994918
Ensembl: ENSCJAG00000013106
Position
5
AA seq 762 aa AA seqDB search
MAVFIILSLFSVLVTGISEGGAGSEKGGERECQLNQLPRCPSISPSAQPWPHPGQSQLFA
DLSREELTAVMRFLTQRLGSGLVDAAQAQPSDNCVFSVELQLPPKVAALAHLDRGSPPPA
REALAIVFFGGQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPMLFREYLDIDQ
MIFDRELPQASGLLHHCCFYKPRGRNLVTMTTAPRGLQSGDRATWLGLYYNISGAGIFLH
PLGLELLVDHKALDPAHWNIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPHNGTGGSWS
LKSPVPPGPAPPLQFYPQGPRFSVQGSRVTSSLWTFSFGLGAYSGPRIFDIRFQGERVAY
EVSVQEALAIYGGNSPSAVRSRYIDSGFGLGHFSTPLTRGVDCPYLATYVDWHFLLESQA
PKTIRDAFCVFEQNQGLPLRRHHSDLYSYYFGGLAETVLVIRSVSTMLNYDYVWDMVFHP
NGAIEIRLHATGYISSAFPFGAAQRYGNKVSQHTLGTVHTHSAHFKVDLDVAGLENWVWA
EDMAFVPMAVPWSPEHQMQRLQVTRKLLETEEQAAFPVGSATPRYLYLASNHSNKWGHPR
GYRIQMISFSGEPLPQNSSMERGFSWERYQMAVTQRKEEEPSSTSIYNLNDPWTPTVDFT
DFINNETIAGQDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSAD
SIYFREDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttcattattttgtccctatttagtgttctggtgacaggcataagtgaaggt
ggggctgggagtgagaaaggaggtgagagggaatgtcaactgaaccagcttccccgctgc
ccctccatatctcccagtgcccagccttggccacaccctggccagagccagctgtttgca
gacctgagccgagaggagctgacagctgtgatgcgctttctgacccagcggctggggtca
ggactggtggatgcagcccaggcccagccctcagacaactgtgtcttctcagtggagctg
caactgcctcctaaggtggctgccctggcccacctggacagggggagccccccacctgcc
cgggaggcactggccatcgtcttctttggtggacaaccccagcccaacgtgagtgagctg
gtggtggggccgctgcctcacccctcctacatgcgggatgtgaccgtggagcgtcatgga
ggccccctgccctatcaccgccgccccatgctgttccgagaatacctggacatagaccag
atgatcttcgacagagagctgccccaggcttctgggcttctccaccactgttgcttctac
aagccccggggacggaacctggtgacaatgaccacagctccccgtggtctacagtcaggg
gaccgggccacctggttgggcctctactacaacatctcaggggctgggatcttcctgcac
cccctgggcttggagctgctggtggaccacaaggccctggaccctgcccactggaacatc
cagaaggtgttctatcaaggccgctactacgacagcctggcccagctggaggcccagttt
gaggctggcctggtgaacgtggtgctgatcccacacaatggcacaggtgggtcctggtcc
ctgaagtcccctgtgcccccgggtccggctccccctctgcagttctatccccagggtccc
cgcttcagtgtccagggaagtcgagtgacctcctcactgtggactttctcctttggcctc
ggagcatacagtggcccaaggatctttgacattcgcttccaaggggagagagtggcctat
gaagtcagcgtccaggaggccttggccatctatggaggcaattctccttctgctgtacga
agccggtatatagacagtggctttggcttgggccacttctccacacccctgacccgtggg
gtggactgcccctacctggccacctacgtggactggcacttccttttggagtcccaggcc
cccaagacaatacgcgatgccttttgtgtgtttgagcagaaccagggtctccccctgcgg
cggcaccactcagatctctactcttactactttgggggccttgcggaaacggtgctggtc
atcagatctgtgtccactatgctcaactatgactatgtgtgggatatggtcttccaccct
aatggggccatagaaatcagactccacgccaccggctacatcagctcagcatttcccttt
ggtgctgcccagaggtatgggaacaaagtttcgcagcacaccctgggcacggtccacacc
catagcgcccacttcaaggtggatctggatgtagcaggactagagaactgggtctgggcc
gaggatatggcctttgtccccatggctgtaccctggagccctgagcaccagatgcagagg
ctgcaggtgacccggaagctgctggagacggaggagcaggctgccttccccgtgggaagt
gccacccctcgctacctgtacctggccagcaatcacagcaacaagtggggtcaccctcgg
ggctaccgcatccagatgatcagcttttctggggagccactgccacagaacagctccatg
gagagaggcttcagctgggagaggtaccagatggcggtaacccagaggaaggaggaggag
cccagtagcaccagcatctacaatttgaatgacccttggacacccactgtggacttcact
gacttcatcaacaatgagaccattgcagggcaggacttggtggcctgggtgacagctggt
tttctgcacatcccacatgcagaggacattcctaacacggtgactgtggggaacggcgtg
ggcttcttcctccgaccctacaacttctttgacgaagacccctccttctactctgccgac
tccatctacttccgagaggaccaggatgccggggcctgtgaggtcaaccccctggcttgc
ctgccccaggctgctgcctgtgcccccgacctccctgccttctcccacgggggcttctct
cacaactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413669Help
Entry
100413669         CDS       T03264                                 

Gene name
AOC3
Definition
(RefSeq) membrane primary amine oxidase
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00260  Glycine, serine and threonine metabolism
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00410  beta-Alanine metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100413669 (AOC3)
   00350 Tyrosine metabolism
    100413669 (AOC3)
   00360 Phenylalanine metabolism
    100413669 (AOC3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100413669 (AOC3)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     100413669 (AOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2 DUF1965
Motif
Other DBs
NCBI-GeneID: 100413669
NCBI-ProteinID: XP_002748050
Ensembl: ENSCJAG00000013106
Position
5
AA seq 759 aa AA seqDB search
MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPRCPSVSHRAQPWPHPGQSQLFADLS
REELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKVAALAHLDRGSPRPAREA
LAIVFFGGQPQPNVSELVVGPLPHPFYMRDVTVERHGGPLPYHRRPVLFREYLDIDQMIF
DRELPQASGLLHHCCFYKPRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGIFLHHVG
LELLVDHKALDPARWSIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPHNGTGGSWSLKS
PVPPGPAPPLQFYPQGPRFSVQGSRVTSSLWTFSFGLGAYSGPRIFDVRFQGERLAYEIS
LQEALAIYGGNSPAAMVTRYVDGSFGMGKYSTPLTRGVDCPYLATYVDWHFLLESQVPKT
IRDAFCVFEQNQGLPLRRHHSDLYSYYFGGLAEMVLVIRSVSTLLNYDYVWDMVFYPNGA
IEIRFHATGYISSAFLFGSTGKYGNQVAEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDM
AFVPMAVPWSPEHQMQRLQVTRKLLETEEQAAFPVGGATPRYLYLASNHSNKWGHSRGYR
IQMISFSGEPLPQNSSMERGFSWERYQLAVTQRKEEEPSSSSIFNQNDPWAPTVDFNDFI
NNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIY
FREDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcaagatagtcctggcgttcctggcactgtccctcattaccatctttgccctg
gcctatgttttgctgaccagcccgggtggttccagccagcctccccgctgcccctctgta
tcccacagggcccagccctggccacaccctggccagagccagctgttcgcagacctgagc
cgagaggagctgacagctgtgatgcgctttctgacccagcggctggggccagggctggtg
gatgcagcccaggcccggccctcggacaactgtgtcttctcagtggagctgcagctgcct
cccaaggtggctgccctggcccacctggacagggggagcccccgacctgcccgggaggca
ctggccatcgtcttctttggtggacaaccccagcccaatgtgagtgagctggtggtgggg
ccgctgcctcaccccttctacatgcgggatgtgaccgtggagcgtcatggaggccctctg
ccctatcaccgccgccccgtgctgttccgagaatacctggacatagaccagatgatcttc
gacagagagctgccccaggcttctgggcttctccaccactgttgcttctacaagccccgg
ggacggaacctggtgacaatgaccacagctccccgtggtctacagtcaggggaccgggcc
acctggtttggcctctactacaacatctcaggggctgggatcttcctccaccatgtgggc
ttggagctgctggtggaccacaaggccctggaccctgcccgctggagcatccagaaggtg
ttctatcaaggccgctactacgacagcctggcccagctggaggcccagtttgaggctggc
ctggtgaacgtggtgctgatcccacacaatggcacaggtgggtcctggtccctgaagtcc
cctgtgcccccgggtccggctccccctctgcagttctatccccagggtccccgcttcagt
gtccagggaagtcgagtgacctcctcactgtggactttctcctttggcctcggagcatac
agtggcccaaggatctttgacgttcgcttccagggagaacgactagcttatgaaatcagc
ctccaagaggccttggccatctatggtggaaattccccagcagcaatggtgacccgctat
gtggatggaagctttggcatgggcaagtactccacgcccctgacccgtggggtggactgc
ccctacctggccacctacgtggactggcacttccttttggagtcccaggtccccaagaca
atacgcgatgccttttgtgtgtttgagcagaaccagggtctccccctgcggcggcaccac
tcagatctctactcttactactttgggggccttgcggaaatggtgctggtcatcagatca
gtgtctaccttgctcaactatgactatgtgtgggatatggtcttctaccccaatggggcc
atagaaatcagattccatgccactggctacatcagctcagcattcctctttggttctact
gggaagtatgggaaccaagttgcagagcacaccctgggcacggtccacacccatagcgcc
cacttcaaggtggatctggatgtagcaggactggagaactgggtctgggccgaggatatg
gcctttgtccccatggctgtgccctggagccctgagcaccagatgcagaggctgcaggtg
acccggaagttgctggagacggaggagcaggccgccttccccgtgggaggcgccacccct
cgctacctgtacctggccagcaaccacagcaacaagtggggtcactctcggggctaccgc
atccagatgatcagcttttctggggagccgctgccgcagaacagctccatggagagaggc
ttcagctgggagaggtaccagctggccgtgacccagcggaaggaggaggagcccagtagc
agcagcatcttcaatcagaatgacccttgggcccccactgtggatttcaatgacttcatc
aacaatgagaccattgctggaaaggacttggtggcctgggtgacagctggttttctgcac
atcccacatgcagaggacattcctaacacggtgactgtggggaacggcgtgggcttcttc
ctccgaccctacaacttctttgacgaagacccctccttctactctgccgactccatctac
ttccgagaggaccaggatgccggggcctgtgaggtcaaccccctggcttgcctgccccag
gctgctgcctgtgcccccgacctccctgccttctcccacgggggcttctctcacaactag

DBGET integrated database retrieval system