KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392306Help
Entry
100392306         CDS       T03264                                 

Gene name
NGFR
Definition
(RefSeq) nerve growth factor receptor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04215  Apoptosis - multiple species
cjc04722  Neurotrophin signaling pathway
cjc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100392306 (NGFR)
   04015 Rap1 signaling pathway
    100392306 (NGFR)
   04010 MAPK signaling pathway
    100392306 (NGFR)
   04151 PI3K-Akt signaling pathway
    100392306 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100392306 (NGFR)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100392306 (NGFR)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100392306 (NGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100392306 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100392306 (NGFR)
   04090 CD molecules [BR:cjc04090]
    100392306 (NGFR)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100392306 (NGFR)
CD molecules [BR:cjc04090]
 Proteins
  100392306 (NGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21 DUF3762
Motif
Other DBs
NCBI-GeneID: 100392306
NCBI-ProteinID: XP_002748499
Ensembl: ENSCJAG00000007164
UniProt: F7C0A9
Position
5
AA seq 427 aa AA seqDB search
MGAGATGRAMDGPRLLLLLLLGVSLGGAKETCPTGLYTHGGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSVPPEGSDITAPSTQEPEAPPEQDIIASTVADAVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLTSWAAQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggagacatgccccacaggcctgtacacacacggc
ggtgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgatgtggtgagcgcgact
gagccgtgcaagccgtgcaccgagtgcgtggggctgcagagcatgtcggcgccttgcgtg
gaggccgacgatgctgtgtgccgctgcgcctacggctactaccaggacgagacaaccggg
cgctgcgaggcttgccgcgtgtgcgaggcaggctccggcctcgtgttctcgtgccaggac
aagcagaacaccgtgtgcgaggagtgccccgacggcacttactccgacgaggccaaccac
gtggacccatgcctgccctgcacagtgtgcgaggacaccgagcgccagctgcgcgagtgc
acgcgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtctgta
ccccctgagggctcagacatcacagcccccagcacccaggagcctgaggcacctccagaa
caagacatcatagccagcacggtggcagatgcggtaaccacagtgatgggcagctcccaa
cctgtggtgacacgaggcaccactgacaacctcatccctgtctattgctccatcctggct
gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaaacag
aacaagcaaggagccaacagccggccggtgaaccagacgccccctccagagggagaaaaa
ctccacagcgacagcggcatctccgtggacagccagagcctgcatgaccagcagccccac
acgcagacggcctcaggccaggccctcaagggtgacggaggcctctacagcagcttgccc
ccagccaagcgggaagaggtggagaagcttctcaacggctctgcaggggacacttggcgg
cacctggcgggcgagctgggctaccagcctgagcacatagactcctttacccacgaggcc
tgcccggtccgcgccttgctcaccagctgggctgcccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagctgaccttgtggagagcctgtgcagcgag
tccactgccacatccccggtgtga

DBGET integrated database retrieval system