KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392363Help
Entry
100392363         CDS       T03264                                 

Gene name
CDKN2B
Definition
(RefSeq) cyclin dependent kinase inhibitor 2B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04934  Cushing syndrome
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05222  Small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100392363 (CDKN2B)
   04068 FoxO signaling pathway
    100392363 (CDKN2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100392363 (CDKN2B)
   04218 Cellular senescence
    100392363 (CDKN2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392363 (CDKN2B)
   05203 Viral carcinogenesis
    100392363 (CDKN2B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100392363 (CDKN2B)
   05222 Small cell lung cancer
    100392363 (CDKN2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100392363 (CDKN2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392363 (CDKN2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 100392363
NCBI-ProteinID: XP_017829391
Ensembl: ENSCJAG00000008048
UniProt: F7I6R0
Position
1
AA seq 138 aa AA seqDB search
MREENKGMPSGGGSDEDLASAAARGQVEKVRQLLEAGADPNGVNRFGRSAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVMLHRAGARLDVRDAWGRLPLDLA
EERGHCDVAGYLRAAAGD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggagaacaagggcatgcccagtgggggcggcagcgatgaggacctggccagc
gccgcggcgcgaggacaagtggagaaggtgcgacagctcctggaggccggcgcggatccc
aacggagtcaaccgctttgggaggagcgcaatccaggtcatgatgatgggcagtgcccgc
gtggcagagctgctgctgcttcacggtgccgagcccaactgtgcggaccctgccactctc
acccgaccggtgcacgacgctgcccgggagggcttcctggacacgctggtgatgctgcac
cgggcaggggcacggctggacgtgcgcgatgcctggggccgtctgcccttggacctggct
gaggagaggggccactgcgatgttgcagggtacctgcgcgcggctgcgggggactga

DBGET integrated database retrieval system