KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392399Help
Entry
100392399         CDS       T03264                                 

Gene name
NLRP3, CIAS1, cryopyrin
Definition
(RefSeq) NLR family pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc05133  Pertussis
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100392399 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100392399 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    100392399 (NLRP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    100392399 (NLRP3)
  09172 Infectious disease: viral
   05164 Influenza A
    100392399 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100392399 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cjc04054]
    100392399 (NLRP3)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100392399 (NLRP3)
Pattern recognition receptors [BR:cjc04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100392399 (NLRP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT NLRC4_HD2 PYRIN NOD2_WH LRR_6 FISNA LRR_4 NB-ARC AAA_16
Motif
Other DBs
NCBI-GeneID: 100392399
NCBI-ProteinID: XP_017822136
Ensembl: ENSCJAG00000011813
Position
19
AA seq 1034 aa AA seqDB search
MKMASTRCKLARYLEDLEDVDFKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWDNACASNHTVICQQDSIEEEWMGLLG
YLSRISICKKKKDYGKKYRRHVRSRFQCIEDRNARLGESVSLNKRYTPLRLIKEHRSQQE
REQELLTIGRTKAGDSPVSPIKMESLFEPDAEHAEPVHTVVFQGAAGIGKTILARKIMLD
WASGTLYQDRFDYLFYIHCRELSLVTQRSLGDLIMSCCPDPNPPIHRIVRKPSRILFLMD
GFDELQGAFDEHIGPLCTDWRKAERGDILLSSLIRKKLLPEAFLLITTRPVALEKLQHLL
DHPRHVEILGFSETKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCTGL
KQQMESGKSLAQTSKTTTAVYIFFLSSLLQPRGGSQEHTLSAHLWGLCSLAADGIWNQKI
LFEESDLRNHGLQKAEVSAFLRMNLFQKEVDCEKLYSFIHMTFQEFFAAMYYLLEEEKEG
GMQNVPGSCLTLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKVS
QQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDHFPKIEINLSTRM
DHVVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDVAQCVPPGSLTACSLGLVN
SHFTSSFCRGLFSVLSTNQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGL
SHECCLDLSLVLSSSQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSA
CCQDVASVLSTSHSLTRLYMGENTLGDAGVEILCEKAKNPQCHLQKLGLVNSGLTSACCS
ALSSVLSTNGNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDSCSLTSHCCWDLS
TLLTSSRSLRKLSLGNNDLGDLGVMMFCEVLRQQSCLLQNLGLCEMFFNYETKRALETLQ
EEKPELTIVFEPSW
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggcaagcacccgctgcaagctggccaggtacttggaggacctggaggatgta
gacttcaagaaatttaagatgcacctagaagactatcctcctcaaaagggctgcatccca
ctcccgaggggtcagaccgagaaggcagaccacgtggatctagccacgctgatgattgac
ttcaatggggaggagaaggcgtgggccatggccgtgtggatcttcgctgcgatcaacagg
agagacctttatgagaaggcaaaaagagatgagcccaaatgggataatgcatgtgcttct
aatcacactgtgatatgccagcaagacagcattgaagaggagtggatgggtttgctgggt
tacctttccagaatctccatttgtaaaaagaagaaagattacggtaagaagtacagaaga
catgtgagaagcagattccagtgcatcgaagacaggaacgcccgtctgggtgagagtgtg
agcctcaacaaacgctacacaccactgcgcctcatcaaggagcaccgcagccagcaggag
agggagcaggagcttctgaccatcggcaggactaaggcaggggacagccccgtgagtccc
attaagatggaatcgctgtttgagcctgatgcagagcacgcggagcctgtgcacacagtg
gtattccagggagccgcggggattgggaaaactatactggccaggaagattatgttggac
tgggcgtcggggacactctatcaagacaggtttgactatttgttctatatccactgtcgg
gagttgagcctcgtgactcagaggagcctgggggacctgatcatgagctgctgccccgac
ccaaacccccccatccacaggatcgtgaggaagccctccagaatcctcttcctcatggac
ggctttgatgagctgcagggtgcctttgatgagcacattgggccactctgcaccgactgg
cggaaggccgagcggggagacattctcctgagcagcctcatcagaaagaagctgctcccc
gaggccttcctgctcatcaccacgagaccggtggccctggagaagctgcagcacttgctg
gaccaccctcggcatgtggagatcctgggtttctcggagaccaaaaggaaggagtatttc
ttcaagtacttctcagatgaggcccaggcgagggcagccttcagtctgattcaggagaac
gaggtcctcttcaccatgtgtttcattcccctcgtctgctggattgtgtgcaccggcctg
aagcagcagatggagagtggcaagagcctggcccagacatccaagactaccactgcggtg
tacatcttcttcctctccagtttgctgcagccccgaggagggagccaggagcataccctc
tctgcccacctctgggggctctgctctttggctgcagatgggatctggaaccagaaaatc
ctctttgaggagtctgacctcaggaatcacggcctgcagaaggcggaggtgtctgctttc
ctgaggatgaacctgttccaaaaggaagtggactgcgagaagctctacagcttcatccac
atgaccttccaggagttctttgctgccatgtactacctgctggaagaggaaaaggaagga
gggatgcagaatgttccagggagttgcttgacgcttcccagccgggacgtgacagtcctt
ctggaaaactacggcaaattcgagaaggggtatttgattttcgttgtgcgtttcctcttc
ggcctggtgaaccaggagaggacctcctacttggagaagaaattaagttgcaaggtctct
cagcagatcaggctggagctgctgaaatggattgaggtgaaggccaaggcaaagaagctg
cagatccagcccagccagctggaattgttctactgtttgtacgagatgcaggaggaggac
tttgtgcagagggccatggaccatttccccaagattgagatcaatctctccaccagaatg
gaccacgtggtttcttccttttgcattgagaactgtcatcgggtggagtccctttccctg
gggtttctccacaacatgcccaaggaggaggaggaagaggagaaggaaggccgacacctc
gacgtggcccagtgtgtacccccaggctctctcactgcctgttccctcgggctggtgaac
agccatttcacttccagcttctgtcggggcctcttctcggttctaagcaccaaccagagt
ctgactgaactggacctgagcgacaattctctgggggacccagggatgagagtgttgtgt
gaaacgctgcagcatcctggctgtaacattcggagattgtggttggggcgatgtggcctc
tcccatgagtgctgcctcgacctctccttggtcctcagcagtagccagaagctggtggag
ttggacctgagcgacaatgccctgggggactttgggatcagactcttgtgcgtgggactg
aagcatctactgtgcaacctgaagaagctctggctggtcagctgctgcctcacgtcagca
tgttgtcaggatgtggcatccgtactgagcaccagccattccctgaccaggctctacatg
ggggagaacactctcggagacgcaggagtagaaattttgtgtgaaaaagccaagaatcca
cagtgtcacctgcagaaactggggttggtaaattctggcctcacatcagcctgttgttca
gctttgtcctcggtactcagcactaatgggaatctcacgcacctttacctgcgaggcaac
actcttggagacaaggggatcaagctcctctgtgagggactcttgcaccccgactgcaag
ctgcaggtgttggaattagacagctgcagcctcacgtcgcactgctgctgggatctttcc
actcttctgacctccagccggagcctgcgaaagctgagcctgggcaacaacgacctgggc
gacctgggggtgatgatgttctgtgaagttctgagacagcagagctgcctcctgcagaac
ctggggttgtgtgaaatgtttttcaattatgagacaaaacgtgcattagaaacacttcaa
gaagaaaagcctgagctgaccattgtctttgagccctcttggtag

DBGET integrated database retrieval system