KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392546Help
Entry
100392546         CDS       T03264                                 

Gene name
GH1, GH, GHB2
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04080  Neuroactive ligand-receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100392546 (GH1)
   04151 PI3K-Akt signaling pathway
    100392546 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100392546 (GH1)
   04060 Cytokine-cytokine receptor interaction
    100392546 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100392546 (GH1)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100392546 (GH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1
Motif
Other DBs
NCBI-GeneID: 100392546
NCBI-ProteinID: NP_001277275
Ensembl: ENSCJAG00000019478
UniProt: Q9GMB3 A0AAU6
Position
5
AA seq 217 aa AA seqDB search
MAAGSWTSLLLAFTLLCLPQLREAGAFPTIPLSRLLDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPASKKETQQKSNLELLRMSLLLIQSWFEPVQFLR
SVFANSLLYGVSDSDVYEYLKDLEEGIQTLMGRLEDGSPRTGEIFMQTYRKFDVNSQNND
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaggctcctggacatccctgctcctggctttcaccctgctctgcctgccccag
cttcgagaggccggtgccttcccaacaattcccttatccaggcttttggacaatgctatg
ctccgtgcccatcgcctgcaccagctggcctttgacacctaccaggagttcgaagaagcc
tatatcccgaaggaacagaagtattccttcctgcagaacccccagacctccctctgcttc
tcagagtctatcccgacacccgccagcaaaaaggaaactcagcagaaatccaacctagag
ctgctccgcatgtccctgctgctcatccagtcctggttcgagcctgtgcagttcctcaga
agtgtcttcgccaacagcctattgtatggtgtctcagacagcgacgtctatgagtacctg
aaggacctagaggaaggcatccaaactctgatggggaggctggaagatggcagcccccgg
actggggagatcttcatgcagacctacaggaagtttgacgtcaactcgcagaacaatgat
gcactgctcaagaactacgggctgctctactgcttccggaaggacatggacaaggtcgag
acgttcctgcgcattgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412128Help
Entry
100412128         CDS       T03264                                 

Gene name
GH1P5, ghlp5
Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04080  Neuroactive ligand-receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100412128 (GH1P5)
   04151 PI3K-Akt signaling pathway
    100412128 (GH1P5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100412128 (GH1P5)
   04060 Cytokine-cytokine receptor interaction
    100412128 (GH1P5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100412128 (GH1P5)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100412128 (GH1P5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1 CLTH
Motif
Other DBs
NCBI-GeneID: 100412128
NCBI-ProteinID: NP_001277281
Ensembl: ENSCJAG00000019478
Position
5
AA seq 217 aa AA seqDB search
MAAVSPASLLLTFTLLCLPWLREAGAFQSIPLSSLYDYAVIRAYRLNHLAFDIYQKFEEA
RSPKEQKNFFQFNARTSLCFSASVPTPTNRKETLQKSNLELLQNSLLLIQMWLKPMQSLN
SVFANSQQHSVSNSFIYEYLKDLEEVIQTLMGRLEDGSPRTGEIFRQTYSKFDRNLHNDD
AVLKNYGLLYCFRRDMNKVATFLRIVKCRAVEGSCGL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtctccccggcatccctgctcctgactttcaccctgctctgcctgccctgg
cttcgagaggccggtgccttccaatcaattcccttatcctcgctttatgactatgctgtg
atccgcgcctatcgcctcaaccacctggcctttgacatctaccagaagtttgaagaagct
cgtagcccgaaggaacagaagaatttcttccagtttaacgccaggacctccctttgcttc
tcagcgtctgtcccaacacccactaacagaaaggaaactctgcagaaatctaacctagag
ctgctccaaaactccctgctgctcatccagatgtggctcaagcccatgcagtccctcaac
agtgtctttgccaacagccaacagcatagtgtctcaaacagcttcatctatgagtacctg
aaggatctagaggaagtcatccaaactctgatggggaggctggaagatggcagcccccgg
actggggagatcttcaggcagacctacagcaagtttgacagaaacttgcacaacgatgat
gcagtgctcaagaactatgggctgctctactgcttccggagagacatgaacaaggtcgca
acattcctgcgcattgtgaagtgccgtgctgtggagggcagctgtggcctctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412471Help
Entry
100412471         CDS       T03264                                 

Gene name
GH1P6, GHB1, ghlp6
Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04080  Neuroactive ligand-receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100412471 (GH1P6)
   04151 PI3K-Akt signaling pathway
    100412471 (GH1P6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100412471 (GH1P6)
   04060 Cytokine-cytokine receptor interaction
    100412471 (GH1P6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100412471 (GH1P6)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  CSF and other factors
   100412471 (GH1P6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1
Motif
Other DBs
NCBI-GeneID: 100412471
NCBI-ProteinID: NP_001277276
Ensembl: ENSCJAG00000019478
UniProt: Q8MI74
Position
5
AA seq 217 aa AA seqDB search
MAAGSRMSLLMAFALLCLPWLQETGALPRIPLSRLFGDAMLRARQLHHLALETYREFEKN
CVPKEQKYFFLRNPETFVCFSESIPTPFHKEEMLGKSNVELLHISLLLIQSWLEPMQRLG
SIFANSQLHSIVNTDVYEYLKDLEEGIQTLTGRLEDGSPQTGEIFRQTYSKFDRSLHNDD
TLLKNYWLLFCFRKDMSKVETFLRIVQCHSVEGSCGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaggctcccggatgtccctgctcatggcttttgccctgctctgcctgccctgg
cttcaagagactggtgcccttccaagaattcccttatccaggctttttggtgacgctatg
ctccgtgcccgtcagctgcaccatctggccttggaaacctaccgggagtttgaaaaaaat
tgtgtcccgaaggaacagaagtatttcttcctgcgtaaccccgagaccttcgtctgcttc
tcagagtctatcccaacacccttccacaaggaggaaatgctgggaaaatccaacgtagag
ctgctccacatctccctgctgctcatccagtcctggcttgaacccatgcagcgcctcggc
agtatctttgccaacagccaactgcatagcatcgtgaacactgatgtctatgagtacctg
aaggacctagaggaaggcatccaaactctgacggggaggctggaagatggcagcccccag
actggggagatcttcaggcagacctacagcaagtttgacagaagcctgcacaacgatgac
acactgctcaagaactactggctgctcttctgcttccggaaggacatgagcaaggtcgag
acattcctgcgcattgtgcagtgccactctgtggagggcagctgtggcttctag

DBGET integrated database retrieval system