KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392568Help
Entry
100392568         CDS       T03264                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00250  Alanine, aspartate and glutamate metabolism
cjc00410  beta-Alanine metabolism
cjc00430  Taurine and hypotaurine metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
cjc04727  GABAergic synapse
cjc04940  Type I diabetes mellitus
Module
cjc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100392568 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100392568 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100392568 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100392568 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100392568 (GAD2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100392568 (GAD2)
Enzymes [BR:cjc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100392568 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100392568
NCBI-ProteinID: XP_002750149
Ensembl: ENSCJAG00000007478
UniProt: F7I4W5
Position
7
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPDNPGTARAWCQVAQKFTGGIGNKLCALLYGDTEKPAEGGG
SQTPRAATRKAACACDHKPCSCSKADVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatccccgggctccggcttttggtccttcgggtctgaagatggctccggggatccc
gacaatcccggcacagcgcgagcctggtgtcaagtggctcagaagttcacaggaggcatc
ggaaacaaactgtgcgccctgctctatggagacacggagaagccggcggagggcggcggg
agccaaaccccgcgggccgccacccggaaggccgcctgcgcctgcgatcataagccttgc
agctgctccaaagcggatgtcaactacgcgtttctccacgcaacagacctgctgccggcg
tgtgatggggaaaggcccactttggcgtttctgcaggatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcccagatacttcaat
caactttccactggattggatatggtgggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaattgccccagtatttgtgcttttggaatatgtcacc
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatggaatattttct
ccaggtggcgccatatctaacatgtatgccatgatgatcgcgcgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacgtctgagcat
agtcatttttctctcaagaagggagctgcagccttagggattggaacagacagcgtgatt
ctgatcaaatgtgatgagagagggaaaatgatcccatctgatcttgaaagaaggattctt
gaagctaaacagaaaggatttgttcctttcctcgtgagtgccacagctggaacaaccgtg
tatggagcatttgaccccctcttagctgtcgctgacatttgcaagaagtataagatctgg
atgcatgtggatgcagcttggggtggtggattactgatgtcccgaaaacacaagtggaaa
ctgagcggcgtggagagggccaactctgtgacgtggaatccacacaaaatgatgggagtc
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactgga
gacaaggccttacagtgcggacgccacgttgatgtttttaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcgcatgttgataagtgtttggagttggcagagtat
ttatacaacatcataaaaaaccgagaaggatatgagatggtgtttgacgggaagcctcag
cacacaaatgtctgcttctggtacattcctccaagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcaaaggtggctccagtgattaaagccagaatgatggagtat
ggaaccacgatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaaccccgcagcaactcaccaagacattgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411537Help
Entry
100411537         CDS       T03264                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00250  Alanine, aspartate and glutamate metabolism
cjc00410  beta-Alanine metabolism
cjc00430  Taurine and hypotaurine metabolism
cjc00650  Butanoate metabolism
cjc01100  Metabolic pathways
cjc04727  GABAergic synapse
cjc04940  Type I diabetes mellitus
Module
cjc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100411537 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100411537 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100411537 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100411537 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100411537 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100411537 (GAD1)
Enzymes [BR:cjc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100411537 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 100411537
NCBI-ProteinID: XP_008996977
Ensembl: ENSCJAG00000006984
UniProt: F6ZJT7
Position
6
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKEKQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcgtccgcaacctcctcgaacgcgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagtgccttcaaggagaagcagtcctccaagaacctgctttcctgtgaa
aatagcgaccgagatggccgcttccggcgcacagagacggacttctccaacctgtttgct
cgagatctgcttccggctaagaacggggaggagcaaactgtgcagttcctcctggaagtg
gtggacatactccttaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccctgagtccctggagcagattctggttgactgcagagacaccttgaagtatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggtcta
gccggagaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacgactgtttatggagcttttgatccaatacaagagattgca
gatatatgtgagaaatacaacctttggctgcatgtcgatgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaatggcatagaaagggccaactcagtcacc
tggaaccctcataagatgatgggcgtgctgttgcagtgctctgccattctcgtcaaggag
aagggtatactccaaggatgcaaccagatgtgtgcaggatatctcttccagccagacaag
cagtatgatgtctcctatgacactggggacaaagcaattcagtgtggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctacgccaagattaaaaacagagaagaattt
gagatggttttcgatggcgagcctgagcacacaaacgtctgtttttggtatattccacaa
agcctccggggtgtgccagatagccctgaacgacgggaaaagctacacaaggtggctcca
aaaatcaaagccctgatgatggagtcaggcacgaccatggttggctaccagccccagggg
gacaaggccaacttcttccggatggtcatctccaatccagccgctacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtag

DBGET integrated database retrieval system