KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392614Help
Entry
100392614         CDS       T03264                                 

Gene name
BUB3
Definition
(RefSeq) BUB3, mitotic checkpoint protein
  KO
K02180  cell cycle arrest protein BUB3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100392614 (BUB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392614 (BUB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100392614 (BUB3)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100392614 (BUB3)
Spliceosome [BR:cjc03041]
 Complex A
  Other components
   Complex A specific factors
    100392614 (BUB3)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100392614 (BUB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 100392614
NCBI-ProteinID: XP_002756721
Ensembl: ENSCJAG00000001066
UniProt: F7BW31
Position
12
AA seq 326 aa AA seqDB search
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEIQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKST
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttctaacgagttcaagctgaaccagccacccgaggatggcatctcctcggtg
aagttcagccccaacacctcccagttcctgcttgtctcctcctgggacacgtcggtgcgc
ctctacgatgtgccggccaactccatgcggctcaagtaccagcacaccggcgcggtcttg
gactgcgccttctacgatccaacgcatgcttggagtggagggctagatcatcaattgaaa
atgcatgatttgaacactgatcaagaaaatcttgttgggacccatgatgctcctatcaga
tgtgttgaatactgtccagaagtgaatgtgatggttactggaagttgggatcagacagtt
aaattgtgggatcccagaactccttgtaatgccgggaccttctctcagcctgaaaaggta
tataccctctcggtgtctggagaccggctgattgtgggaacagcaggccgcagagtgttg
gtgtgggacttacggaacatgggttacgtgcagcagcgcagggagtccagcctgaaatac
cagactcgctgcatacgagcgtttccaaacaagcagggttatgtattaagttccattgaa
ggccgagtggcagttgagtatttggatccaagtcctgagatacagaagaagaaatatgcc
ttcaaatgtcacagactaaaagaaaataatattgagcagatttacccagtcaatgccatt
tcttttcacaatatccacaatacatttgccacaggtggttccgatggctttgtaaatatt
tgggatccatttaacaaaaagcggttgtgccagttccatcggtaccccacgagcatcgca
tcacttgccttcagtaatgatgggactacgcttgcaatagcatcatcatatatgtatgaa
atggatgacacggaacatcctgaagatggtatcttcattcgccaagtgacagatgcagaa
acaaaacccaagtccacctaa

DBGET integrated database retrieval system