KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392730Help
Entry
100392730         CDS       T03264                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04622  RIG-I-like receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100392730 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100392730 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100392730 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100392730 (IFNE)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interferons
   100392730 (IFNE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon DUF1027
Motif
Other DBs
NCBI-GeneID: 100392730
NCBI-ProteinID: XP_008995949
Position
1
AA seq 207 aa AA seqDB search
MIIKHFFEILLVLLASITIFSLDLKLVLLQQRRVNQESLKLFKLQTSSIQQCLQHRKNFM
LPQKSMSSQQHXKGYTLAILHEMLQQIFSIFRADISLDGWEENHMEKFLIQLHQHLEYLE
ALMGLEAEKLSGTLGSDNLRLQVKMYFQRIHDYLENQDYSSCAWAIVRVEINRCLFFVFS
LTRKLSNQGRPLKDMEQKLTTESRSPG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaagcacttctttgaaattttgttggtgctgctggcctctatcactatcttc
tctctagatctgaaactggttcttttacagcaaagaagagtgaaccaagaaagcttaaaa
ctctttaagttgcaaacctcatcaattcagcagtgtctacaacacaggaaaaactttatg
cttcctcagaagtctatgagttctcaacagcactgaaaaggatatactctggccattctc
catgagatgcttcagcaaatcttcagcattttcagggctgatatttctctggatggctgg
gaggaaaaccacatggagaaattccttattcaacttcatcaacatctggaatacctagaa
gcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataaccttaga
ttacaagttaaaatgtacttccaaagaatccatgattacctggaaaaccaggactacagc
agctgtgcctgggccattgtccgagtagaaatcaaccgatgtctattctttgtgttcagt
ctcacaagaaagctgagcaatcaaggaagacccttgaaagacatggaacaaaagcttacc
acagagtctagaagcccagggtag

DBGET integrated database retrieval system