KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393072Help
Entry
100393072         CDS       T03264                                 

Gene name
IL23R
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc04659  Th17 cell differentiation
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100393072 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393072 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100393072 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393072 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100393072 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100393072 (IL23R)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL6/12 receptor family
   100393072 (IL23R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 IL6Ra-bind IL12p40_C Lep_receptor_Ig PriX ObR_Ig
Motif
Other DBs
NCBI-GeneID: 100393072
NCBI-ProteinID: XP_002750981
Ensembl: ENSCJAG00000017407
UniProt: F6TY15
Position
7
AA seq 630 aa AA seqDB search
MNQVTTQWDVVIALYTLFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCKAAIKNCQ
PRKLHFYKNGIRERFQITRINKTTARLWYQNFLEPHASMYCTAECTKHFQETLICGKDIS
SGYPPDVPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYVN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSASIISKAETINATVPKTII
YWYSQTTIEKVSCEMRYKAATNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCRETG
KRYWQSWSSPFFHKTPETVPQVTPKSFQHDTWNSGLLVSSISTRHLTSDNRDDIGLLLGM
IVFAVVLSILSLIGILNRSLRTGIKRRILFLIPKWLYEDIPNMKNSNVVKMLQEKSELMN
DNSSEQVLYVDPMITEISEIFIPQHRPTDHKKEKNTAPLETRDYLQNSPFDNTTVVYIPD
LNTGYKPQISNFLPGGNHLSKNDEITSLTLKPPFDSLDLGNNPRLKKHPNFAFSVSSVNS
LSNTLFLEELSLILNQGECSPPDIQNSIEEEPTTLLENNSPNETIPEQTLLPDEFVSCLG
ILNEELPSTNSYFPQNILESHFSRISLLEK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggtcactactcaatgggatgtggtaatagctctttacacactcttcagttgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagagccagccaca
atttttaagatgggcatgaatatctctatatattgcaaagcagcgattaagaactgccaa
ccaaggaaacttcatttttataaaaacggcatcagagaaagatttcaaatcacaaggatt
aacaaaacaacagctcggctttggtatcaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtaccaaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatgttcctgatgaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggtg
catgtgaagagtttagagacagaagaagagcaacaatatctcacctcaagctatgttaac
atctccactgattcattacaaggtggtaagaagtatttggtttgggtccaagcagcaaac
gcactaggcatggaggagtcaaaacaactgcagattcacctggatgatatagtgatacct
tctgcatccatcatttccaaggctgagactataaatgctacagtgcccaagaccataatt
tattggtatagtcagacgacaattgaaaaggtttcctgtgaaatgagatacaaggctgca
acaaaccaaacttggaatgttaaagagtttgacaccaattttacatatgtgcagcagtcg
gaattctacttggagccaaatattaagtatgtatttcaagtgagatgtcgagaaacaggc
aaaaggtactggcagtcttggagttctccgttttttcataaaacacctgaaacagttccc
caggtcacaccaaaatcattccaacatgacacatggaattctggacttctagtttcttcc
atctctacgagacaccttacttctgacaacagagatgacattggacttttattgggaatg
atcgtctttgctgttgtgttgtcaattctttctttgattgggatacttaacagatcactc
agaactggaattaaaagaagaatcttatttttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctgcaggaaaaaagtgaactcatgaat
gataattccagtgaacaggtcctatatgttgatcccatgattacagagataagcgaaatc
tttatcccacaacacaggcctacagaccacaagaaggaaaagaatacagcacccctggag
acaagagactaccttcaaaactcgccattcgacaatactacggttgtgtatattcctgat
ctcaacactggatataaaccccaaatttcaaactttctgcctggaggaaaccatctcagc
aaaaatgacgaaatcacttccttaacacttaaaccaccatttgattccttagacttagga
aataatcccaggttaaaaaagcatcctaattttgctttttctgtctcaagcgtgaattca
ctgagtaacacactatttcttgaagaattaagcctcatattaaatcaaggagaatgcagt
cctcctgacatacaaaactcaatagaggaggaacccaccacgcttttggaaaacaattca
cccaatgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgcttgggg
atcctgaatgaggagttgccatctactaattcttattttccacaaaatattttggaaagc
cacttcagtcggatttcactcttggaaaagtag

DBGET integrated database retrieval system