KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393236Help
Entry
100393236         CDS       T03264                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04144  Endocytosis
cjc04150  mTOR signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04310  Wnt signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04921  Oxytocin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04972  Pancreatic secretion
cjc05100  Bacterial invasion of epithelial cells
cjc05133  Pertussis
cjc05152  Tuberculosis
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100393236 (RHOA)
   04015 Rap1 signaling pathway
    100393236 (RHOA)
   04310 Wnt signaling pathway
    100393236 (RHOA)
   04350 TGF-beta signaling pathway
    100393236 (RHOA)
   04072 Phospholipase D signaling pathway
    100393236 (RHOA)
   04071 Sphingolipid signaling pathway
    100393236 (RHOA)
   04024 cAMP signaling pathway
    100393236 (RHOA)
   04022 cGMP-PKG signaling pathway
    100393236 (RHOA)
   04150 mTOR signaling pathway
    100393236 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100393236 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100393236 (RHOA)
   04520 Adherens junction
    100393236 (RHOA)
   04530 Tight junction
    100393236 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100393236 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100393236 (RHOA)
   04621 NOD-like receptor signaling pathway
    100393236 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100393236 (RHOA)
   04660 T cell receptor signaling pathway
    100393236 (RHOA)
   04670 Leukocyte transendothelial migration
    100393236 (RHOA)
   04062 Chemokine signaling pathway
    100393236 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100393236 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100393236 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100393236 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100393236 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100393236 (RHOA)
  09158 Development
   04360 Axon guidance
    100393236 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393236 (RHOA)
   05206 MicroRNAs in cancer
    100393236 (RHOA)
   05205 Proteoglycans in cancer
    100393236 (RHOA)
   05203 Viral carcinogenesis
    100393236 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100393236 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100393236 (RHOA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100393236 (RHOA)
   05152 Tuberculosis
    100393236 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100393236 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100393236 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100393236 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100393236 (RHOA)
   04031 GTP-binding proteins [BR:cjc04031]
    100393236 (RHOA)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100393236 (RHOA)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100393236 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100393236 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100393236 (RHOA)
  Exosomal proteins of bladder cancer cells
   100393236 (RHOA)
GTP-binding proteins [BR:cjc04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100393236 (RHOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 100393236
NCBI-ProteinID: XP_002758388
Ensembl: ENSCJAG00000003904
UniProt: F6RB87
Position
15
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattcggaagaaactggtgattgttggtgatggagcctgtggaaaaacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca
gctggacaggaagattatgatcgcctgagacccctctcctacccagacaccgatgttatt
ctgatgtgtttttccatcgacagtcctgatagtttagaaaacatcccagaaaagtggacc
ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggaacctgtgaaa
cctgaagaaggaagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacaagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system