KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393440Help
Entry
100393440         CDS       T03264                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01523  Antifolate resistance
cjc04060  Cytokine-cytokine receptor interaction
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04657  IL-17 signaling pathway
cjc04659  Th17 cell differentiation
cjc04668  TNF signaling pathway
cjc04672  Intestinal immune network for IgA production
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05020  Prion diseases
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
cjc05332  Graft-versus-host disease
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100393440 (IL6)
   04668 TNF signaling pathway
    100393440 (IL6)
   04066 HIF-1 signaling pathway
    100393440 (IL6)
   04068 FoxO signaling pathway
    100393440 (IL6)
   04151 PI3K-Akt signaling pathway
    100393440 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393440 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100393440 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100393440 (IL6)
   04620 Toll-like receptor signaling pathway
    100393440 (IL6)
   04621 NOD-like receptor signaling pathway
    100393440 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100393440 (IL6)
   04625 C-type lectin receptor signaling pathway
    100393440 (IL6)
   04659 Th17 cell differentiation
    100393440 (IL6)
   04657 IL-17 signaling pathway
    100393440 (IL6)
   04672 Intestinal immune network for IgA production
    100393440 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393440 (IL6)
   05202 Transcriptional misregulation in cancer
    100393440 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100393440 (IL6)
   05321 Inflammatory bowel disease (IBD)
    100393440 (IL6)
   05332 Graft-versus-host disease
    100393440 (IL6)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100393440 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100393440 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100393440 (IL6)
   04931 Insulin resistance
    100393440 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100393440 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100393440 (IL6)
   05133 Pertussis
    100393440 (IL6)
   05134 Legionellosis
    100393440 (IL6)
   05152 Tuberculosis
    100393440 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393440 (IL6)
   05162 Measles
    100393440 (IL6)
   05164 Influenza A
    100393440 (IL6)
   05161 Hepatitis B
    100393440 (IL6)
   05168 Herpes simplex virus 1 infection
    100393440 (IL6)
   05163 Human cytomegalovirus infection
    100393440 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100393440 (IL6)
   05169 Epstein-Barr virus infection
    100393440 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100393440 (IL6)
   05144 Malaria
    100393440 (IL6)
   05142 Chagas disease (American trypanosomiasis)
    100393440 (IL6)
   05143 African trypanosomiasis
    100393440 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100393440 (IL6)
   01523 Antifolate resistance
    100393440 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100393440 (IL6)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100393440 (IL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6 IL11 IL23 GCSF
Motif
Other DBs
NCBI-GeneID: 100393440
NCBI-ProteinID: NP_001254700
Ensembl: ENSCJAG00000001400
UniProt: Q0Z973
Position
8
AA seq 212 aa AA seqDB search
MNSLSTSAFRPVAFSLGLLLVMPAAFPAPVPLGEDSKEVAAPNRQLLTSTERIDKHIRYI
LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL
EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQKKAKNLSAIATPDPATNASLLTKLQ
AQDQWLQGVTTHLILRSFKEFLQNSLRALRQM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctctccacaagcgccttcagaccagttgccttctccctggggctgctcctg
gtgatgcctgctgccttccctgccccagtacccctgggagaagattccaaagaggtagct
gccccaaatagacagctactcacctctacagaacgaattgacaaacacattcggtacatc
ctcgacggcatctcagccttgagaaaggagatatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggcagaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctgctgaaaatcaccactggtcttttg
gagtttgaagtatacctagagtacctccagaacaggtttgagagtagcaaggaacaagcc
ggagctgtgcagatgagtacaaaaggcctgatccagtccctgcagaaaaaggcaaagaat
ctaagtgcaatagccacccctgacccagccacaaatgccagcctgctgacgaagctgcag
gcacaggaccagtggctgcagggcgtgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagaacagtctgagggctcttcggcaaatgtag

DBGET integrated database retrieval system