KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393468Help
Entry
100393468         CDS       T03264                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100393468 (DOCK8)
Membrane trafficking [BR:cjc04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100393468 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100393468
NCBI-ProteinID: XP_017828778
Ensembl: ENSCJAG00000010485
Position
1
AA seq 2098 aa AA seqDB search
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNTLDVQLAQELGDLTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRD
CIQTYIREWLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPDAQTGPR
HLNVLCDVSGKGPLTACDFDLRSLQPDQRLENLLQQVSAEDFEKQNEEARRTNRQAELFA
LYPTVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYMVIRESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLERE
VTDVDPVVGRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVNSFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGLLRLEVSTAPEIINCCLTPEMLPVRPFPENRTRP
HKEILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDAGNAMPV
IFGKSSGPEFLQEVYAAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGG
SVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISETALEHELKLSIICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKD
QHGRNCLLASYVHYVFRLPEPQRDMPKSGAPTALPDPRYHTYGRTSAAAVSSKLLQARVL
SSSNPDLAGTHSEADEEVKNIMSSKVADRNCSRMSYYCSGNNDVPSSTTAPRPASKKHFH
EELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQYVHNMDKRDSVRRTRFSDRFMDDIT
TIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFTLIRHYCNQLSA
KLSNLPMLISMRLEFLRILCSHEHYLNLNLFFMNADTVPTSPCPSISSQNSSSCSSFQDQ
KIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISRVQRKAVSAIHSLLSSHDLDAR
CVKPEVKVKIAALYLPLVGIILDALPQLYDFTATRCWKSRTSGSDEEQEGASAINQNVAL
AIAGNHFNLKTSGMMLSSLPYKQYNMLSADTTRSLMICFLWIMKNADQSLIRKWIADLPS
VQLNRILDILFICVFCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRR
RAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEANLIILDMQ
ENIIQASSALDCKDSLLGGVLRVLVRSLNCDQSTTYLTHCYATLRALIAKFGDLLFEEEV
EQCANLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLAFLVGR
APDFNEEHLRRSLRTILAYLEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDPE
MLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVAEYLSMLED
HSYLPVGSVSFQNISSNVLEESVVSDDTLSPDEDGVCVGQYFTESGLVGLLEQASELFST
GGLYETVNEVYKLVIPILEAHREFRKLTLIHSKLQRTFDSIVNKDHKRMFGTYFRVGFYG
SKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPHKA
YIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTT
MHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQVPPDPKMLQMVLQGSV
GATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFILRCGEAVEKNKRLITPDQRE
YQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS
NT seq 6297 nt NT seq  +upstreamnt  +downstreamnt
atggccactctgccgagcgcagagcgccgcgcgtttgcgctgaagatcaacaggtattct
tcagcggaaataaggaaacagtttactctcccaccaaaccttggccagtaccatcgacag
agcataagcacctctggcttcccctctcttcaactacctcagttttatgaccctgtggag
ccggtggactttgaaggacttctgatgacacacctgaacactctggatgtgcagcttgcc
caggagctcggggacctcactgatgatgacttggacgtggtgttcacgccaaaggaatgt
aggactttgcagccctctttgccggaggaaggggttgaactggaccctcatgtcagggac
tgtattcagacctacattcgggagtggctaatcgtgaaccggaaaaatcaaggaagtcca
gaaatttgtggctttaaaaagactggatctcgaaaagattttcacaagacgcttccgaag
cagacgtttgagtcggaaaccttggagtgcagtgaacccgatgctcagacaggcccccgc
cacttaaacgtgctgtgcgatgtgtctgggaaaggccccctcactgcctgtgactttgac
ctccgcagcctgcagcctgaccagcggctagaaaaccttctgcagcaagtaagtgctgag
gactttgagaagcagaatgaggaggcccggaggaccaatcggcaggctgagctctttgcc
ctttacccaacagtggatgaggaggatgctgtggaaatacgtccggtaccagaatgtccc
aaggaacatctgggcaacagaatattggtcaagttgctgaccttaaagttcgagatcgaa
attgagcctctgtttgccagcattgccctctatgatgttaaagaaaggaaaaagatctca
gaaaattttcactgtgacctgaactctgaccagttcaaaggatttctgcgagctcacacg
ccttcggtggccgcatcaagtcaggcaagatctgcagttttctcggtcacctacccgtcc
tcggacatctacctggtggtcaagattgaaaaagtcctacagcagggagagattggagac
tgtgcagagccctacatggttatcagagaaagtgatgggggaaagagtaaagaaaagatt
gaaaaactaaaactccaagctgaatctttctgccagcgtttggggaaatacaggatgccc
tttgcctgggcacccataagcttatccagcttcttcaatgtctccacccttgagagggag
gtaaccgatgtggaccctgtggttgggagaagctcagtgggtgaacggaggactttggcc
caatctagacggctttctgaaagagccctctccttggaggaaaatggggttggatccaac
ttcaaaacctctaccctgagcgtgaacagctttttcaagcaggaaggagatcgccttagt
gatgaagacttattcaagtttttagctgactacaaaagatcttcatccttacagagacga
gtcaagtcaattccaggcttgctcagactggaggtttctacagctccagagatcatcaat
tgctgtctgactcctgaaatgctgcctgtgagaccctttcctgaaaaccggacacgccca
cacaaagagattttggaatttccaatacgagaagtatatgtccctcatactgtgtacaga
aatcttctctatgtctacccacagaggctgaacttcgctaacaaactagcatcagcccgg
aacattacaataaagatccagtttatgtgtggagaagatgctggcaacgcgatgccggtc
atctttggaaagtccagcgggcctgaatttctgcaggaagtatacgcagccattacatac
cataataagtctcctgacttttatgaagaagtgaaaattaagcttcctgctaagctcaca
gtaaatcaccacctcctgttcaccttctaccatatcagctgtcagcagaagcaaggaggc
tccgtggaaactctcctgggatattcgtggctgccaattcttttaaatgaacgtcttcaa
actggatcgtactgtctcccagttgccttggaaaaattgccacccaactactccatgcat
tctgctgagaaagtccccttacagaatcctcccattaagtgggctgaaggacataaggga
gtatttaatatagaagtgcaagctgtttcctctgtgcatacccaggacaaccacctggag
aaattcttcaccctctgccactccctggagagccaggtgaccttccccatccgcgtgctg
gatcagaagatcagtgagacggcactggagcacgagctgaagctcagcatcatctgcctg
aactcctcccgcctggagccgctcgtgctcttcctgcacctggtgctggacaagctcttc
cagctgtctgtgcagcccatggtcattgctggccagacagccaacttctcccagtttgcc
ttcgagtccgtggtggccatcgccaacagtctgcacaacagcaaggacctgagcaaggac
cagcacgggaggaactgcctgctggcttcctacgtgcactacgtcttccgcctgccggag
ccacaaagggacatgcccaagtcaggtgctcccactgccctccccgatccccgctatcac
acgtatggacgcacatcagctgctgccgtgagttcgaagctgctgcaggcccgggtgttg
agcagcagtaacccagaccttgcggggacacactccgaagcagacgaggaagtgaagaac
atcatgtcttcaaaggtcgccgatcgcaactgcagccgaatgtcttactattgctctggc
aataatgatgttccaagttcaactacagcaccaaggccagccagcaaaaagcatttccat
gaggagcttgccctccagatggtggtcagcactggaatggtgagagaaacagtcttcaag
tacgcctggttcttctttgagcttctggtgaaaagcatggcccagtatgtacataacatg
gacaaacgggatagtgttcggaggactcgtttttctgaccgtttcatggatgacataact
actattgttaatgtggtcacctcggagattgcagccctgttagtaaaaccgcagaaggaa
aatgaacaggcggaaaagatgaacatcagcctggctttcttcttgtatgaccttctctcc
ctcatggataggggctttgtgtttaccctcatcaggcattattgcaaccagctgtcagcc
aagctcagtaaccttccaatgctcatttccatgaggctggagttcctgagaatcctctgt
agccatgaacattacctcaatctgaaccttttttttatgaatgctgatactgttccaaca
tctccttgtccttccatatcttctcagaactcaagctcctgctccagtttccaagaccag
aagatcgccagcatgtttgatctgacttctgagtaccgccagcagcacttcctcacgggg
cttctcttcaccgaactggctgctgccttagatgccgaaggggaaggaatcagcagagtg
caaaggaaagctgtcagtgccattcacagcctgctaagttctcatgacctggacgcacgc
tgtgtcaaaccagaggtgaaggtcaaaattgctgccctgtacctgcctttagttggcatc
attttggatgctttgccacagctctatgactttacagctacacgttgttggaaaagtcgc
accagtggctcggatgaagaacaagaaggagccagtgccatcaaccagaacgtggctctg
gccattgcagggaatcattttaatttgaaaacaagtggaatgatgctgtcttccttgccc
tataagcagtacaacatgctgagtgcggacaccacccgcagcctcatgatctgcttcctc
tggatcatgaaaaatgctgatcagagcctcattaggaagtggattgctgacctgccgtca
gtgcaactcaacagaattttagatatacttttcatctgtgtcttctgttttgagtacaag
ggaaaacagagttctgataaagtcagtacccaagtcttgcagaagtcaagggatgtcaag
gcccggctggaagaggctttgctccgtggggaaggggccagaggggagatgatgcgccgc
cgggctccagggaatgaccgatttccaggactaaatgaaaatttgagatggaagaaagag
cagacacattggcggcaagctaatgagaagctagataaaacaaaggcagagttagatcaa
gaagccttgatcagtggcaatctggctacagaagcaaatttaatcatcctggatatgcag
gaaaacattatccaggcaagctcggctctggactgtaaagacagcctgctgggaggtgtt
ttgagggtgctggtgcgttctctgaactgtgatcagagcaccacctacctgactcactgc
tatgcaacactccgcgccctcattgccaagtttggagacttactctttgaagaggaggtg
gaacagtgtgccaacctgtgtcaccaagtcctgcaccactgtagcagcagcatggatgtc
acccggagccaagcctgcgccacgctttacctcctcatgaggttcagttttggagccacc
agtaactttgcaagagtaaagatgcaagtaaccatgtcgctggcatttttggtgggcaga
gcaccagactttaatgaagagcacctgagaagatccttgaggacaattttggcctattta
gaagaggacacggccatgcagatgactccttttcccacccaggtggaggaacttctctgt
aatctgaatagcatcttatatgacacggtgaagatgagggaatttcaggaagatcctgag
atgctcatggatctcatgtacagaattgccaagagttaccaggcatctcctgatctgcgg
ctgacctggctccagaacatggcagagaaacacaccaagaggaagtgctacacggaggcc
gccatgtgcctggtgcatgccgctgccttagtggccgagtatctgagcatgctggaggac
cacagctacctgcccgtgggcagtgtcagcttccagaatatttcttccaatgtgctggag
gagtctgtggtctctgatgacacgctatcgcctgatgaggatggagtgtgtgtaggccag
tatttcaccgagagtggcctggtgggcctcctggagcaggcttcagagctcttcagcacg
ggaggcttatatgagacagttaatgaggtctacaagctggtcatccccatcctagaagcg
catcgagaattccggaagctgaccttgattcacagcaagctgcagaggacctttgacagc
attgtcaacaaggatcacaagagaatgtttggaacctacttccgagttggtttctatgga
tccaaatttggggatttggatgaacaggaatttgtttacaaagagcctgcaattaccaag
cttcctgagatctcacacagactagaggcattttacggtcaatgttttggtgcagaattt
gtggaagtgattaaagactccactcctgtggacaaaaccaagttggatcctcacaaggcc
tacatacagatcacttttgtggagccctactttgatgagtatgagatgaaagacagggtc
acatactttgaaaagaatttcaaccttcggaggttcatgtacaccaccccgttcaccctg
gaggggcggcctcggggagagctgcatgagcagtacagaagaaacacggtcctgaccacc
atgcatgccttcccctacatcaagacgaggatcagcgtcatccagaaggaggagtttgtt
ttgacaccgattgaagttgccattgaagacatgaagaaaaagaccctgcagttagcggtt
gccattaaccaggtgccccctgatccaaagatgcttcaaatggtgctgcaaggctctgta
ggagctactgtaaatcagggaccactggaagtagcccaagtgttcttggctgaaattcct
gctgatccaaaactctatcgacatcacaacaagttgaggttatgctttaaggaattcatc
ctgcgatgtggtgaagctgtagagaaaaacaagcgtctcatcacaccagaccagagggag
tatcagcaggaactcaaaaagaactataacaagctaaaagagaacctcagaccaatgatt
gagcggaaaattccagaactctacaagccaatattcagagttgagagtcaaaagagggac
tctttccacagatctagtttcaggaaatgtgaaacccagttgtcacagggcagctaa

DBGET integrated database retrieval system