KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393511Help
Entry
100393511         CDS       T03264                                 

Gene name
IL4I1
Definition
(RefSeq) interleukin 4 induced 1
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00250  Alanine, aspartate and glutamate metabolism
cjc00270  Cysteine and methionine metabolism
cjc00280  Valine, leucine and isoleucine degradation
cjc00350  Tyrosine metabolism
cjc00360  Phenylalanine metabolism
cjc00380  Tryptophan metabolism
cjc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjc01100  Metabolic pathways
Module
cjc_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100393511 (IL4I1)
   00270 Cysteine and methionine metabolism
    100393511 (IL4I1)
   00280 Valine, leucine and isoleucine degradation
    100393511 (IL4I1)
   00350 Tyrosine metabolism
    100393511 (IL4I1)
   00360 Phenylalanine metabolism
    100393511 (IL4I1)
   00380 Tryptophan metabolism
    100393511 (IL4I1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100393511 (IL4I1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     100393511 (IL4I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 HI0933_like Pyr_redox AlaDh_PNT_C FAD_binding_3 Thi4 FAD_oxidored GIDA Pyr_redox_3 MCRA Lycopene_cycl UDPG_MGDP_dh_N 3HCDH_N FMO-like NAD_binding_7 Trp_halogenase DUF1188 TrkA_N
Motif
Other DBs
NCBI-GeneID: 100393511
NCBI-ProteinID: XP_017822930
UniProt: U3DQ35
Position
22
AA seq 568 aa AA seqDB search
MAPLVLRLLGLVPILLGLAASQDWKTEGSQDPFEKCMHDPDYEQLLKVVTLGLDRTLKPR
RVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDRNTGWIGELGAMRMPSS
HRILHRLCQGLGLNLTKFTQYDENTWTEVHEVKLRNYMVEKLPEKLGYALRPQEKGHSPE
DIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFY
LSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSEPVLLNAPVVAITQGPHDVHVQ
IKTFPRARNLKALKADVVLLTASGPAVQRITFSPPLPRHVQEALRGLHYVPATKVFLSFR
RPFWREEDIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAATFAGLSQEEALRLAL
DDVAALHGPFVRQLWDGTGVVKRWAEDPHSQGGFVVQPPALWHTEKDYEPYDWSVPYGRI
YFAGEHTAYPHGWVETAVKSALRAAIKINSREEPAFETASPEGQRQRQGPAHGVAGSPSS
DLAEEEGSHPPVQGQLPLQHTTYTRTWH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggccccgctggtcctacgcctcctcggcctcgtccccatcctcctcggcctggcagcc
tcccaggactggaagaccgaaggcagccaggaccccttcgagaaatgcatgcacgatcct
gactacgagcagctgctcaaggtggtgaccctgggccttgatcggaccctcaagccccgg
agggtgattgtggttggtgctggcgtggctgggctggtggctgccaaggtgctcagcgat
gccggacacaaggtcaccatcctagaggcagataacaggatcgggggccgaatcttcacc
taccgggaccggaacacgggctggattggggagctgggagccatgcgcatgcccagctcc
cacaggatcctccacaggctctgccagggcctgggactcaacctcaccaagttcacccag
tacgacgagaacacgtggacggaggtgcatgaggtgaagctgcgcaactacatggtagag
aagctgcccgagaagctgggctacgccctgcggccccaggaaaaggggcactcgcccgaa
gacatctaccagatggctctcaaccaggccctcaaagacctgaaggcactgggctgcaga
aaggcaatgaagaagtttgaaaggcacacgctcttggaatacctcctcggggaggggaac
ctgagccggccggccgtacagcttctgggagacgtgatgtccgaggatggcttcttctat
ctcagctttgccgaggccctccgggcccacagctgccttagcgacaggctgcagtacagc
cgcatcgtgggtggctgggacctgctgccacgcgcgctgctgagctcgctgtctgagcct
gtgctgttgaacgcgcccgtcgtggcgataacccaggggccgcatgatgtgcacgtgcag
atcaagacctttccccgagcgcggaatctgaaggcgctgaaggccgatgtggtgctgctg
accgcgagcgggccggcggtgcagcgcatcaccttctcgccgccgcttccccgccacgtg
caggaggcgctgcggggactgcactacgtgccggccactaaggtgttcttgagcttccgc
aggcccttctggcgcgaggaggacatcgagggcggccactcgaacacagaccgcccgtcg
cgcatgattttctacccgccgccgcgcgagggcgcgctgctgctggcctcgtacacttgg
tcggacgcggccgcgacattcgccggcctgagccaggaagaggcgctgcgcttggcactg
gacgacgtggctgcgctgcacgggccgttcgtgcgccagctctgggacggcaccggcgtc
gtcaagcgctgggccgaggacccgcacagccagggtggcttcgtggtgcagccgccggcg
ctctggcacactgaaaaggattacgagccgtacgactggtctgtgccttacggccgcatc
tacttcgccggcgagcacaccgcctacccgcacggctgggtggagacggcggtcaagtcg
gcgctgcgagccgccatcaaaatcaacagccgggaggagcctgcattcgagacggccagc
ccagaggggcagaggcagaggcaggggcccgcgcatggggtggcgggcagcccctcgtct
gacctggcagaggaagagggcagccaccctccagtccaaggccagttacctctccagcac
actacctacacaaggacctggcattaa

DBGET integrated database retrieval system