KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393569Help
Entry
100393569         CDS       T03264                                 

Gene name
TBX6
Definition
(RefSeq) T-box 6
  KO
K10180  T-box protein 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100393569 (TBX6)
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100393569 (TBX6)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Other transcription factors
   T-box
    100393569 (TBX6)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100393569 (TBX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 100393569
NCBI-ProteinID: XP_002756081
Ensembl: ENSCJAG00000035904
UniProt: F6PNW2
Position
12
AA seq 436 aa AA seqDB search
MYHPRELYPSLGAGYRLGPPQPGADSSFPPALAEGYRYPDLDTPKLDCFLSGMEAAPRTL
AAPPPLPLLPPAMGTEPAPSAPEALHSLPGVSLILENRELWKEFSSVGTEMIITKAGRRM
FPACRVSVTGLDPEARYLFLLDVVPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPA
TGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFR
FPETTFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATEA
CGSGDTPGGPCDSTLGGDIRESDPEQALALGEATTVPVPPCGGPSAEAYLLHPAAFHGAP
SHLPTRSSSFPEAPDSGRSAPYSAAFLELPPGPGASGYPAAPPATPFAPHFLQGGPFPLP
YPGPGGYLDVGSKPMY
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatccacgagagttgtacccgtccctgggggccggctaccgcttggggcccccc
caacccggggcagactccagcttcccacctgccctagctgagggctaccgctaccctgac
ctggatacccccaaactggattgcttcctctccgggatggaggctgctccccgcaccctg
gccgctcccccacctctgccccttctgccccctgccatgggcacagagccggccccatca
gctccagaggccctccattccctccctggggtcagcctcatcctggagaaccgggagcta
tggaaggagttcagctctgtgggaacagaaatgatcatcaccaaagctgggaggcgcatg
ttccctgcctgccgagtgtcagtcaccggcctggacccggaggcccgctacttgtttctt
ctggatgtggttccagtggacggggctcgctaccgctggcagggccggcgctgggagccc
agcggcaaggcagagccccgcctgcctgaccgagtctatattcaccccgactctcctgcc
acgggtgcccattggatgcggcagcctgtgtccttccatcgtgtcaagctcaccaacagc
acgctggatccccacggccacctgatcctgcactccatgcacaagtaccagccccgcata
catctggttcgagcagcccagctctgcagccagcactgggggggtatggcctccttccgc
ttccccgagaccacattcatctctgtgacagcctaccagaacccacggatcacacaactg
aagattgcagccaatccctttgccaaaggcttccgggagaacggcagaaactgtaagagg
gagcgagacgcccgtgtgaagaggaaactgcggggcccagagccagcagccacagaggcc
tgtgggagcggagacaccccaggtggtccctgcgactccaccctgggtggagacattcgt
gaatcagatccagagcaggccctagccctgggggaagccaccactgtcccggtgcctccg
tgcggtggccccagtgccgaggcctacctcctgcaccctgcagctttccacggggctccc
agtcaccttcccaccaggagctccagcttcccggaggctccagactctgggcgctcagcc
ccctactcagctgcatttctggagctgccacctgggccaggggcctctgggtacccagcg
gctccgccagcaacaccctttgccccccactttctccaagggggccccttccctctacca
taccctgggcctgggggctacctggatgtgggctccaaacccatgtactga

DBGET integrated database retrieval system