KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393687Help
Entry
100393687         CDS       T03264                                 

Gene name
CAMKK2
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04140  Autophagy - animal
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04920  Adipocytokine signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100393687 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100393687 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100393687 (CAMKK2)
   04921 Oxytocin signaling pathway
    100393687 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    100393687 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100393687 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100393687 (CAMKK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100393687 (CAMKK2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  CAMKK family
   100393687 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100393687
NCBI-ProteinID: XP_002753145
Ensembl: ENSCJAG00000001450
UniProt: F7I4J2
Position
9
AA seq 541 aa AA seqDB search
MSSCVSNQPSSNRAAPQDDLGGRGSSSSESQQPCAALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEAPLDTSGSQARPHLSGRKLSLQERSQPGLAAGGSLNMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDNLQGTDPPPVGEEEVL
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtgtctctaaccagcccagcagcaaccgggccgccccccaggatgatctg
gggggcaggggcagcagcagcagcgaaagccagcagccctgtgcggccctgcggggcctc
tcatccttgagcatccacctgggcatggagtccttcatcgtggttaccgagtgtgagccg
ggctgtgctgtggatcttggcctggcccgggaccggcctctggaggccgatggccaagag
gccccccttgacacctccgggtcccaggcccggccccacctctctggtcgcaagctgtct
ctgcaagagcggtcccagcctgggctggcagccggcggcagcctcaacatgaacggacgc
tgcatctgcccatccttgccctactcgcctgtcagctccccgcagtcctcgcctcggctg
ccccggcggcccacagtggagtctcaccatgtctccatcacgggtatgcaggactgtgtg
cagctgaatcagtataccctgaaggatgaaattggaaagggctcctatggcgtcgtcaag
ttggcctacaatgaaaatgacaacacctactatgcaatgaaggtgctgtccaaaaagaag
ctgatccggcaggccggctttccacgtcgccccccaccccgaggcacccggccagcccct
ggaggctgcatccagcccaggggccccattgagcaggtgtaccaggaaatcgccatcctc
aagaagctggaccaccccaatgtggtgaagctggtggaggtcctggatgaccccaacgag
gaccatctgtacatggtgttcgaactggtcaaccaagggcccgtgatggaagtgcccact
ctcaaacctctttctgaagaccaggcccgtttctacttccaagatctgatcaaaggcatc
gagtacttacactaccagaaaatcatccaccgtgacatcaaaccttccaacctcctggtc
ggagaggatgggcacatcaagattgccgactttggtgtgagcaacgagttcaagggcagc
gacgctctcctctccaacactgtgggcacgcccgccttcatggcgcccgagtcgctctct
gagacccgcaagatcttctctgggaaggcattggatgtttgggccatgggtgtgaccctc
tactgctttgtctttggccagtgcccattcatggacgagcggatcatgtgtttacacagt
aagatcaagagtcaggccctggaatttccagaccagccggatatagctgaggacttgaag
gatctgatcacccgtatgctggacaagaaccctgagtcgagaattgtggtgccagaaatc
aagctgcacccctgggtcacgaggcatggggcggagccgttgccgtcggaggacgagaac
tgcacgctggtcgaagtgaccgaagaggaggtcgagaactcagtcaaacatattcccagc
ctggcgaccgtgatcctggtgaagaccatgattcggaagcgctcctttgggaacccattt
gaggggagccggcgggaggagcgctccttgtcagctcctggaaacctgctcacgaagcaa
ggcagcgaagacaacctccagggcaccgacccgccccccgtgggggaggaggaagtgctt
ttgtga

DBGET integrated database retrieval system