KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393710Help
Entry
100393710         CDS       T03264                                 

Gene name
TNFRSF11A
Definition
(RefSeq) TNF receptor superfamily member 11a
  KO
K05147  tumor necrosis factor receptor superfamily member 11A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04380  Osteoclast differentiation
cjc04917  Prolactin signaling pathway
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100393710 (TNFRSF11A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393710 (TNFRSF11A)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100393710 (TNFRSF11A)
  09158 Development
   04380 Osteoclast differentiation
    100393710 (TNFRSF11A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100393710 (TNFRSF11A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100393710 (TNFRSF11A)
   04090 CD molecules [BR:cjc04090]
    100393710 (TNFRSF11A)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100393710 (TNFRSF11A)
CD molecules [BR:cjc04090]
 Proteins
  100393710 (TNFRSF11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RANK_CRD_2 TNFR_c6 Chordopox_A13L
Motif
Other DBs
NCBI-GeneID: 100393710
NCBI-ProteinID: XP_008978174
Ensembl: ENSCJAG00000003331
Position
13
AA seq 521 aa AA seqDB search
MAPRARRRHPLPALLLLCALLARLQVALPIAPPCTSERHYERLGRCCSKCEPGKYMSSKC
TTNSDSICLPCGPDEYLDTWNEEDKCLLHKVCDSGKALVAVDIGNSTAPRRCTCMVGYHW
SQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDTFSSADKCRPWTNCTILGK
KVERHGTEKSDVICSSSLPSRKPPNEAQVFLPGLIILLLFTSVALVAAIIFGVYYRKKGK
ALTANLWHWINEACGRLSGDKESSGDSCVSTHTTTFGQQGVCESVLLLTLEEKTFPDDMC
YPNQGGVCQGTCAGGGPYTQGEGARMLSLVIETETEEDGFRQMPTEDEYMDRPSQPADRL
LFLTEPGSRSTPPFSEPLEVGENDSLSQCFTGTQSMVGSESCNCTEPLCGTDWSSENYLQ
KEVDGGHCPHWAASSSPNWADVCTGCQNPPGEDCEPLEGSPKHGPLPRCTYGMGLPPEKE
AGRAEAGDQPEDGDDGRPPGSMRAGTGSASSPGGQAPASGK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgtgcccggaggcgtcacccgctacccgcgctgctgctgctctgcgcgcta
ctcgcccgactgcaggtggccctgccgatcgctcctccatgtaccagtgagaggcattat
gagcgtctgggacggtgctgtagcaaatgtgaaccaggaaagtacatgtcttctaaatgc
actactaactctgacagtatatgtctgccctgtggcccagatgaatacttggatacctgg
aatgaagaagataagtgcttgctgcataaagtttgtgattcaggcaaggccctggtagct
gtggacatcggcaacagcacggccccccggcgctgcacctgcatggtcgggtaccactgg
agccaggactgcgagtgctgccgccgcaacaccgagtgtgcgccaggcctgggcgcccag
cacccgttgcagctcaacaaggacacggtgtgcaaaccttgcctcgcaggctacttctca
gacaccttttcctccgcggacaaatgcagaccctggaccaactgtaccatccttggaaag
aaagtagaacgtcacgggacagagaaatccgatgtgatttgcagttcttctctgccatcc
agaaaaccaccaaatgaagcccaggttttcttgccgggtttaataattctgcttctcttc
acatctgtggccctagtggctgccatcatctttggcgtttactataggaaaaaagggaaa
gcactcacagctaatttgtggcactggatcaatgaggcctgtggccgcctaagtggagat
aaggagtcctcaggcgacagttgtgtcagtacacacacgacaacttttggtcagcaagga
gtgtgtgaaagtgtcttactgctgactctggaggagaagacatttccagatgatatgtgc
tacccaaatcaaggtggtgtctgtcagggcacatgtgcaggaggtgggccctacacacaa
ggcgaaggtgccaggatgctctctttggtcatcgagaccgagacggaggaagatggcttc
agacagatgcccacggaagatgaatacatggacaggccgtcgcagcccgcagaccgttta
ctgttcctcactgagcctggaagcagatccacacctcctttctccgaacccctggaggtg
ggggagaatgacagtttaagccagtgcttcacggggacgcagagcatggtgggttcagaa
agctgcaattgcactgagcccctgtgcgggactgactggtcctctgaaaactacttgcaa
aaagaggtggacggtggccattgccctcactgggcagccagctccagccccaactgggca
gatgtctgcacaggctgccagaaccctcctggggaggactgtgagcccctggagggttcc
ccaaaacatggacccttgccccggtgcacctatggcatgggccttccccctgaaaaagaa
gccggcagggcggaggctggagaccagcctgaggacggggacgatgggaggcccccaggc
tccatgagggcaggcaccggttctgcaagctcccctggtggccaggcccctgcatctggt
aagtga

DBGET integrated database retrieval system