KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393782Help
Entry
100393782         CDS       T03264                                 

Gene name
CFLAR
Definition
(RefSeq) CASP8 and FADD like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04140  Autophagy - animal
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04668  TNF signaling pathway
cjc05142  Chagas disease (American trypanosomiasis)
cjc05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100393782 (CFLAR)
   04668 TNF signaling pathway
    100393782 (CFLAR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100393782 (CFLAR)
  09143 Cell growth and death
   04210 Apoptosis
    100393782 (CFLAR)
   04217 Necroptosis
    100393782 (CFLAR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100393782 (CFLAR)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100393782 (CFLAR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100393782 (CFLAR)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C14: caspase family
   100393782 (CFLAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 100393782
NCBI-ProteinID: XP_008997446
Ensembl: ENSCJAG00000004505
UniProt: F7IMN8
Position
6
AA seq 480 aa AA seqDB search
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSLVSLAELLY
RVRRFDLLKRILKMDRKAVEDHLLRHPHLVSDYRVLMAEIGENLDKSDVSSLIFLMRDYM
GRGKINKEKSFLDLVVELEKRNLVAPDQLDLLEKCLKNIHRLDLKTKIQKYKQSAQGAGT
SYKNVLQAAIKNSFKDPSNNFRLHNGRSKEQRLKEQLGTQQEPVKTSIQESEAFLPQSMP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKSLHLTMDGILQVLQRVACMP
QHQDYDSFVCVLVSRGGSQTVYGVDQTHPGLPLHHIRRMFMGDLCPYLVGKPKVFFIQNY
MVSEGQLEDSSLLEVDGPAMKNVESKSQQRGPCTVHREADFFWSLCTADVSLLEESCGSP
SLYLQCLSQKLRQERKRPLLDLHIELNSHMYDWNSRVSAKEKYDVWLQHTLRKKLILSYT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaggtcatccatcaggttgaagaagcacttgacacagatgagaaggagatg
ctgctctttttgtgccgggatgttgctatagatgtggttccacctaatgtcagggacctt
ctggatattttacgtgaaagaggtaagctctctctcgtgagcttggctgaactgctctac
agagtgaggcgattcgacctgctcaagcggatcttgaaaatggacagaaaagccgtggag
gaccacctgctcaggcaccctcaccttgtttcggactacagagtgctgatggcagagatc
ggtgagaatttggataaatctgatgtgtcctcattaattttcctcatgagggattatatg
ggccgaggcaagataaacaaggagaagagtttcttggaccttgtggttgagttggagaaa
cgaaatctggttgccccagatcaactggatttattagaaaaatgcctaaagaacatccac
agattagacctgaagacaaaaatccagaagtacaagcagtctgctcaaggagcagggaca
agttacaagaatgttctccaagcagcaatcaaaaacagtttcaaggatccttcaaataac
ttcaggctccataatgggagaagtaaagaacaaagacttaaggaacaacttggcactcaa
caagaaccagtgaagacatccattcaggaatcagaagcttttttgcctcagagcatgcct
gaagagagatacaagatgaagagcaagcccctaggaatctgcctgataatcgattgcatt
ggcaatgagacagagcttcttcgagataccttcacttccctgggctatgaagttcagaaa
tccttgcatctcactatggatggtatattacaggttcttcaacgagttgcctgtatgccc
caacaccaagactacgacagctttgtgtgtgtcctggtgagccgaggaggctcccagact
gtgtatggtgtggatcagactcacccagggctccccctgcatcacatcaggaggatgttt
atgggagatttatgcccttatctagtagggaagccaaaggtgttttttattcagaactat
atggtgtcagagggccagctggaggacagcagcctcctggaggtggatgggccagcgatg
aagaatgtggaatccaagtctcagcagcgagggccgtgcacagttcaccgagaagctgac
ttcttctggagcctttgcactgcagatgtgtccctgctggaagagtcctgtggctcaccg
tccctgtacctgcagtgcctctcccagaaactgagacaagaaagaaaacgtccactcctg
gatctccacattgaactcaatagccacatgtatgattggaacagcagagtttctgctaag
gagaaatacgatgtctggctgcagcacactctgagaaagaaacttatcctctcttacaca
taa

DBGET integrated database retrieval system