KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393808Help
Entry
100393808         CDS       T03264                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04144  Endocytosis
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04371  Apelin signaling pathway
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04659  Th17 cell differentiation
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05142  Chagas disease (American trypanosomiasis)
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05321  Inflammatory bowel disease (IBD)
Module
cjc_M00680  TGF-beta signaling
cjc_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100393808 (SMAD3)
   04390 Hippo signaling pathway
    100393808 (SMAD3)
   04371 Apelin signaling pathway
    100393808 (SMAD3)
   04068 FoxO signaling pathway
    100393808 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100393808 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100393808 (SMAD3)
   04218 Cellular senescence
    100393808 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100393808 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100393808 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100393808 (SMAD3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100393808 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393808 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100393808 (SMAD3)
   05212 Pancreatic cancer
    100393808 (SMAD3)
   05225 Hepatocellular carcinoma
    100393808 (SMAD3)
   05226 Gastric cancer
    100393808 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100393808 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100393808 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393808 (SMAD3)
   05161 Hepatitis B
    100393808 (SMAD3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100393808 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 100393808
NCBI-ProteinID: XP_017832175
Ensembl: ENSCJAG00000002088
UniProt: U3DU44
Position
10
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaaggactccctcatgtcatctactgccgcctgtggcgatggcccgacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggta
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatt
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagaccccg
ccccctggctacctgagtgaagatggagagacgagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacaataacttggac
ctgcagccagtcacctactgcgagccagccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacgttccatgcctcgcagccatccatgactgtggatggcttc
accgacccctccaactcggagcgcttctgcctagggctgctctctaacgtcaacaggaac
gcagcagtggagctgacgaggaggcacattggaagaggcgtgcggctctactacattgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatctttgtccagtctcccaactgt
aaccagcgctatgggtggcacccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccaatccgtcaaccagggcttc
gaggctgtctaccagttgacccgcatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagactgtgaccagtaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396826Help
Entry
100396826         CDS       T03264                                 

Gene name
SMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04144  Endocytosis
cjc04218  Cellular senescence
cjc04350  TGF-beta signaling pathway
cjc04371  Apelin signaling pathway
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04659  Th17 cell differentiation
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05142  Chagas disease (American trypanosomiasis)
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05321  Inflammatory bowel disease (IBD)
Module
cjc_M00680  TGF-beta signaling
cjc_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100396826 (SMAD2)
   04390 Hippo signaling pathway
    100396826 (SMAD2)
   04371 Apelin signaling pathway
    100396826 (SMAD2)
   04068 FoxO signaling pathway
    100396826 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100396826 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100396826 (SMAD2)
   04218 Cellular senescence
    100396826 (SMAD2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100396826 (SMAD2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100396826 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100396826 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100396826 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100396826 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100396826 (SMAD2)
   05212 Pancreatic cancer
    100396826 (SMAD2)
   05225 Hepatocellular carcinoma
    100396826 (SMAD2)
   05226 Gastric cancer
    100396826 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100396826 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100396826 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100396826 (SMAD2)
   05161 Hepatitis B
    100396826 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100396826 (SMAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 100396826
NCBI-ProteinID: XP_008978001
Ensembl: ENSCJAG00000004630
UniProt: F7HWK8
Position
13
AA seq 467 aa AA seqDB search
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcacgccgccagttgtgaagagactgctgggatggaagaag
tcagctggtgggtctggaggagcaggcggaggagagcagaatgggcaggaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagctgaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaactgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtctccaggtatcccatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccccgacatactgagatcctaacagaacttccgcctctggatgactatactcactccatt
ccagaaaacactaacttcccggcaggaattgagccacagagtaattatattccagaaacg
ccgcctcctggatatatcagtgaagatggagaaacaagtgaccaacagttgaatcaaagt
atggacacaggctctccagcagaactatctcctactactctttcccctgttaatcatagc
ttggatttacagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaatcagagggttggagaaaccttccatgcatctcagccctcgctcactgtagat
ggctttacagacccatcaaattcagagaggttctgcttaggtttactctctaatgttaac
cgaaatgccacagtagaaatgacaagaaggcacataggaagaggagtgcgcttgtattac
ataggtggggaagtttttgccgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatatggctggcaccctgcaaccgtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtctatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagtactccttgctggattgaactt
catctgaatggacctctgcagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system