KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393860Help
Entry
100393860         CDS       T03264                                 

Gene name
GABARAPL2
Definition
(RefSeq) GABA type A receptor associated protein like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04136  Autophagy - other
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04371  Apelin signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04727  GABAergic synapse
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100393860 (GABARAPL2)
   04068 FoxO signaling pathway
    100393860 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100393860 (GABARAPL2)
   04136 Autophagy - other
    100393860 (GABARAPL2)
   04137 Mitophagy - animal
    100393860 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100393860 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    100393860 (GABARAPL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100393860 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100393860 (GABARAPL2)
   04121 Ubiquitin system [BR:cjc04121]
    100393860 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100393860 (GABARAPL2)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    100393860 (GABARAPL2)
Ubiquitin system [BR:cjc04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100393860 (GABARAPL2)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100393860 (GABARAPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 100393860
NCBI-ProteinID: XP_008984476
Ensembl: ENSCJAG00000014253
UniProt: F7HV98
Position
20
AA seq 117 aa AA seqDB search
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaggaccactctttggaacacagatgcgtggagtccgcgaag
atccgagcgaaatatcctgaccgggttccggtgattgtggaaaaggtctcaggctctcag
attgttgacattgacaaacggaagtacttggttccatctgatatcactgtggctcagttc
atgtggatcatcaggaaaaggatccagcttccttctgaaaaggcgatcttcctgtttgtg
gataagacagtcccacagtccagcctaactatgggacagctttacgagaaggaaaaagat
gaagatggattcttgtatgtggcctacagcggagagaacactttcggcttctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399942Help
Entry
100399942         CDS       T03264                                 

Gene name
GABARAPL1
Definition
(RefSeq) GABA type A receptor associated protein like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04136  Autophagy - other
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04371  Apelin signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04727  GABAergic synapse
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100399942 (GABARAPL1)
   04068 FoxO signaling pathway
    100399942 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100399942 (GABARAPL1)
   04136 Autophagy - other
    100399942 (GABARAPL1)
   04137 Mitophagy - animal
    100399942 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100399942 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    100399942 (GABARAPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100399942 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100399942 (GABARAPL1)
   04121 Ubiquitin system [BR:cjc04121]
    100399942 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100399942 (GABARAPL1)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    100399942 (GABARAPL1)
Ubiquitin system [BR:cjc04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100399942 (GABARAPL1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100399942 (GABARAPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12 VitD-bind_III
Motif
Other DBs
NCBI-GeneID: 100399942
NCBI-ProteinID: XP_002752204
Ensembl: ENSCJAG00000021670
UniProt: F7HVH6
Position
9
AA seq 117 aa AA seqDB search
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccagtacaaggaggaccatcccttcgagtatcggaaaaaggaaggagaaaag
attcggaagaaatatccggacagggtccccgtgattgtagagaaggctccaaaagccagg
gtgcctgatctggacaaaaggaagtacctagtgccctccgaccttaccgttggccagttc
tacttcttaatccggaagagaatccacctgagacctgaggacgccttattcttctttgtc
aacaacactatccctcctaccagtgctaccatgggccaactctatgaggacaatcatgag
gaagactattttctctatgtggcctacagtgatgagagtgtctatgggaaatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404267Help
Entry
100404267         CDS       T03264                                 

Gene name
GABARAP
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04136  Autophagy - other
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04371  Apelin signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04727  GABAergic synapse
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100404267 (GABARAP)
   04068 FoxO signaling pathway
    100404267 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100404267 (GABARAP)
   04136 Autophagy - other
    100404267 (GABARAP)
   04137 Mitophagy - animal
    100404267 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100404267 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    100404267 (GABARAP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100404267 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100404267 (GABARAP)
   04121 Ubiquitin system [BR:cjc04121]
    100404267 (GABARAP)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100404267 (GABARAP)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    100404267 (GABARAP)
Ubiquitin system [BR:cjc04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100404267 (GABARAP)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100404267 (GABARAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 100404267
NCBI-ProteinID: XP_002748033
Ensembl: ENSCJAG00000016655
UniProt: F7ANW4
Position
5
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaagagcatccattcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacaatgggtcaactttaccaggaacaccatgaa
gaagacttctttctgtacattgcctatagtgacgaaagtgtctacggtctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108591978Help
Entry
108591978         CDS       T03264                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04136  Autophagy - other
cjc04137  Mitophagy - animal
cjc04140  Autophagy - animal
cjc04371  Apelin signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04727  GABAergic synapse
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108591978
   04068 FoxO signaling pathway
    108591978
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108591978
   04136 Autophagy - other
    108591978
   04137 Mitophagy - animal
    108591978
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108591978
  09156 Nervous system
   04727 GABAergic synapse
    108591978
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    108591978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    108591978
   04121 Ubiquitin system [BR:cjc04121]
    108591978
   03029 Mitochondrial biogenesis [BR:cjc03029]
    108591978
Membrane trafficking [BR:cjc04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    108591978
Ubiquitin system [BR:cjc04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   108591978
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108591978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 108591978
NCBI-ProteinID: XP_017828594
Position
5
AA seq 105 aa AA seqDB search
MKLQYKEHHPFKYLKKEGENIRKKYPDRVPEIVEKAPKARVPDLDKSKYLVPSDLTGANS
TSFFVLVFLRRKENHLRPEDALFFFVNNTVSPANVPMDQLYGGQS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcagtacaaggagcaccatccctttaagtatctgaaaaaggaaggagaaaat
atcaggaagaaatatccggacagggtccccgagattgtagagaaggctccaaaggccagg
gtgcctgatctggacaagagtaagtacctagtgccctctgaccttaccggggccaattct
acttctttttttgttcttgtttttttgagacggaaagagaaccacctgagacctgaggat
gccttattcttctttgtcaacaacactgtttctcctgctaatgttcccatggaccaactg
tatgggggacaatcatga

DBGET integrated database retrieval system