KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393866Help
Entry
100393866         CDS       T03264                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04514  Cell adhesion molecules (CAMs)
cjc04650  Natural killer cell mediated cytotoxicity
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05150  Staphylococcus aureus infection
cjc05164  Influenza A
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05323  Rheumatoid arthritis
cjc05416  Viral myocarditis
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100393866 (ICAM1)
   04668 TNF signaling pathway
    100393866 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100393866 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100393866 (ICAM1)
   04670 Leukocyte transendothelial migration
    100393866 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100393866 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100393866 (ICAM1)
   05416 Viral myocarditis
    100393866 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100393866 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100393866 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393866 (ICAM1)
   05164 Influenza A
    100393866 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100393866 (ICAM1)
   05169 Epstein-Barr virus infection
    100393866 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100393866 (ICAM1)
   05143 African trypanosomiasis
    100393866 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100393866 (ICAM1)
   04090 CD molecules [BR:cjc04090]
    100393866 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100393866 (ICAM1)
   04091 Lectins [BR:cjc04091]
    100393866 (ICAM1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100393866 (ICAM1)
CD molecules [BR:cjc04090]
 Proteins
  100393866 (ICAM1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Hyaluronan
  Cell surface receptors
   100393866 (ICAM1)
Lectins [BR:cjc04091]
 I-type lectins (Siglecs)
  100393866 (ICAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N Ig_2 Ig_3 C2-set_2 I-set Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 100393866
NCBI-ProteinID: XP_008985482
UniProt: U3B8W1
Position
22
AA seq 535 aa AA seqDB search
MAPSGPRPALPALLVLLAALLPGPGEAETSVFPQVVILPRGGSVLVNCSSSCDQRPFLGL
ETPLTKREVLPGGNNWKMFELSNVQEDSQPICFSNCGGRQSTAKTFLTVYWTPERVELAP
LPAWQPVGENLTLRCQVEGGAPRANLTVMLLRGEEELSRQPVVGEPAEVTVTVLAGRDDH
GASFSCRTELDLRSQGLELFENTSAPHQLQTFVLPVTPPQLLSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQKLNHTITYGIDALSAKALVKGTAEEEGTQRLLCAVILGNQSQE
TRGTMTVYSFPAPKVILTEPEVSEGTEVIVKCEGHPRAMVMLNGVPAQTPGPRTQLRLKA
RPEDDGRSFSCSATLEVAGQVVHKNQTRELRVLYGPQLDEKHCPRNWTWPENSQQTPTCQ
AWGNPSPQLECLKDGTLPLPIGKSVTVTRDLSGTYLCRATSTRGEATCEVTVNVVTVPSP
RHEMVIIAVVVTVAILSTAGFAVYLYNRQRKIRKYRLQRAQNGTPMKPITQATPP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcggcccccggcccgcgctgcctgcgctcctggtcctgctcgcggctctg
ctcccaggacctggcgaagctgagacgtctgtgttcccccaagtggtcatcctgccccgg
ggtggctccgtgctagtgaactgcagcagctcctgtgatcagaggcccttcttgggcctg
gagactccgttgactaaaagggaggtgctcccaggtgggaacaactggaagatgtttgaa
ctgagcaatgtgcaggaagacagccagccaatatgcttttcaaactgcggcggcagacag
tccacggccaaaaccttcctcaccgtgtactggactccagaacgggtggagctggcaccc
ctccctgcttggcagccagtgggcgagaaccttaccctacgctgccaggtggagggcggg
gcaccccgggccaacctcaccgtgatgctgctccgtggggaagaggagctgagccggcag
ccagtggtgggggagcccgccgaggtcacggtcacggtgctcgcaggcagagatgatcac
ggagccagtttctcgtgccgcactgaattggacctgcggtcccaagggctggagctgttt
gagaacacctcggccccccaccagctccaaacctttgtcctgccagtgactccaccacaa
cttctcagcccccgggtcctggaggtggatacgcaggggaccgtggtctgttccctggat
gggctgttcccagtctcggaggcccaggtccacctggcgctgggggaccagaagctgaac
cacacaatcacctatggcatcgatgccctctcggccaaggccttggtcaaggggaccgca
gaggaggagggcacccagcggctgttgtgtgcagtaatactagggaaccagagccaggag
acacgggggacaatgactgtctacagctttccggcacccaaagtgattctgacggagcct
gaggtctcagaaggaactgaggtgattgtgaagtgtgagggccaccccagagctatggtg
atgctgaatggggtcccagcccagacaccgggcccgaggacccagttacggctgaaggcc
aggccagaggacgatgggcgcagcttctcctgctctgcgaccctggaggtggccggacag
gttgtacacaagaaccagacccgggagctccgtgtgctgtacggcccccaactggacgag
aagcattgtccaagaaactggacgtggccagaaaactcccagcagactccgacatgccag
gcttggggaaatccctcaccccagcttgagtgtctaaaagatggcactttgcccctgccc
atcgggaaatcagtgactgtcacacgggatctctcgggcacctacctctgtcgggccacg
agcactcgaggggaggccacctgcgaagtgaccgtgaatgtggtgaccgtgccctccccc
cggcatgagatggtcatcatcgctgtcgtggtgactgtagcaatcctgagcactgcaggc
ttcgccgtgtacctctataaccgccagaggaagatcaggaaatacagactccaacgggct
caaaacgggacccccatgaaacccatcacacaagccacgcctccctga

DBGET integrated database retrieval system