KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393945Help
Entry
100393945         CDS       T03264                                 

Gene name
IL1R1
Definition
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04380  Osteoclast differentiation
cjc04640  Hematopoietic cell lineage
cjc04659  Th17 cell differentiation
cjc04750  Inflammatory mediator regulation of TRP channels
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100393945 (IL1R1)
   04064 NF-kappa B signaling pathway
    100393945 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100393945 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100393945 (IL1R1)
   04659 Th17 cell differentiation
    100393945 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100393945 (IL1R1)
  09158 Development
   04380 Osteoclast differentiation
    100393945 (IL1R1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100393945 (IL1R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393945 (IL1R1)
   05163 Human cytomegalovirus infection
    100393945 (IL1R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100393945 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100393945 (IL1R1)
   04090 CD molecules [BR:cjc04090]
    100393945 (IL1R1)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL1 receptor family
   100393945 (IL1R1)
CD molecules [BR:cjc04090]
 Proteins
  100393945 (IL1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 Ig_2 I-set Ig_6 ig Ig_5 TIR_2
Motif
Other DBs
NCBI-GeneID: 100393945
NCBI-ProteinID: XP_002757499
Ensembl: ENSCJAG00000008354
UniProt: U3DT41
Position
14
AA seq 569 aa AA seqDB search
MKVLLRLTCFIALLISSLEADKCKEREGKIILVSSASEIDVRACPLNPNENKGTITWYKN
DSKTPISTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSHCLKIKITAKFVENEPNL
CYNAQAIFKQKLPIGGDGALVCPYLEFFKDENNELPKMQWYKDCKPLLLDTIHFSGVKER
LIVMNVTEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMAVDL
GSQIQLICNVTGQLSDVAYWKWNGSLIDEDDPVLEEDYYSVENPSNKKKSTLITVLNISE
IESRFYEHPFTCFAKNTHGVDAAYIQLIYPAPNFQKHMIGICVMLTVIIMCSIFIYKIFK
IDIVLWYRDSCYVFLPVKASDGKTYDAYILYPKTTGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENIKKSRRLIIILVREVSGFSWLDGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPLSKHQLLSLATKEKLQREAHMPLG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactcagacttacttgtttcatagctctcctgatttcttctctggaggct
gataaatgcaaggaacgtgaaggaaaaataattttagtttcatctgcaagtgaaattgat
gttcgtgcctgtcctcttaacccaaatgaaaacaaaggtactataacttggtataaaaat
gacagcaagacacctatatctacagaacaagcctccaggatccatcagcacaaagagaaa
ctttggtttgttcctgctaaggtagaggattcaggacattactattgtgtggtaagaaat
tcatctcactgcctcaaaattaaaataactgcaaaatttgtggagaatgagcctaacttg
tgttataatgcacaagccatatttaagcagaaactacccattggaggagatggagcactt
gtctgcccttatctagagttttttaaagatgaaaataatgagttacctaaaatgcagtgg
tataaggattgcaaacctctacttcttgacactatacactttagtggagtcaaagaaagg
ctcatcgtgatgaatgtgactgaaaagcatagagggaactatacctgtcatgcatcctac
acatacttgggcaagcaatatcctattacccgggtaatagaatttattactctagaggaa
aacaaacccacgaggcctgtgatcgtgagcccagccaacgagacaatggcggtagacctg
ggatctcagatacaattgatctgtaatgtcactggccagttgagtgatgttgcttactgg
aagtggaatgggtcattaattgatgaagatgacccagtgctggaggaagactactacagt
gtggaaaatccttcaaacaaaaaaaaaagtaccctcatcacagtgcttaatatatcggaa
attgaaagtagattttatgaacatccatttacctgttttgccaagaatacacatggtgta
gatgcagcgtatattcagttaatatatccagcccctaatttccagaagcacatgattggt
atatgtgtgatgttgacagtcataattatgtgttccattttcatctataaaatcttcaag
attgatattgtgctttggtacagggattcctgctatgtttttcttccagtaaaagcttca
gatggaaagacctatgatgcatatatactgtatccaaagaccactggggaagggtctacc
tctgactgtgatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtgga
tataagctgttcatttacggaagggatgactatgttggggaagacattgttgaggtcatt
aatgaaaacataaagaaaagcagaagactgattatcattttagtcagagaagtatcaggc
ttcagttggctggatggttcatctgaagagcaaatagccatgtataatgctcttgttcag
gatggaattaaagttgtcctgcttgagctggagaaaatccaagactatgagaaaatgcca
gaatctattaaattcattaaacagaaacatggggctatccgctggtcaggggacttcaca
cagggaccacagtctgcaaagacaaggttctggaagaacgtcagataccacatgccagtc
cagcgacggtcgcctttatctaaacaccagttactgtcactggctactaaggagaaactt
cagagagaggctcacatgcctcttgggtag

DBGET integrated database retrieval system