KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394036Help
Entry
100394036         CDS       T03264                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc03420  Nucleotide excision repair
cjc03430  Mismatch repair
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100394036 (RPA2)
   03420 Nucleotide excision repair
    100394036 (RPA2)
   03430 Mismatch repair
    100394036 (RPA2)
   03440 Homologous recombination
    100394036 (RPA2)
   03460 Fanconi anemia pathway
    100394036 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100394036 (RPA2)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100394036 (RPA2)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100394036 (RPA2)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100394036 (RPA2)
   MMR (mismatch excision repair)
     100394036 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100394036 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon TFA2_Winged_2 MarR_2
Motif
Other DBs
NCBI-GeneID: 100394036
NCBI-ProteinID: XP_008999000
Position
7
AA seq 343 aa AA seqDB search
MGREDRNKSSIRGHRLAEARSTRPLTGSVIRGKEFVAPEKSIQSRXVAAEFWVVPQLAQI
GTFSPSLRRIETKMWNSGFESFGSSNYGGAGGYTQSPGGFGSPGPSQAEKKSRARAQHIV
PCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHTEKAPTNIVYKIDDMTAPPMDVRQW
VDTDDASSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTAHILEVINAHM
ILSKASGQPSAGKAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF
QELRNQLKHMSVPSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagaggacaggaacaagagcagcattcgtggacaccgattggctgaagcgaga
agcactcggccgctgactggctcggtcattcgcgggaaggagtttgtggcgccagaaaaa
agtatccagagccgctgagtagcggccgagttctgggttgttccgcaacttgcccagatc
ggaaccttctcgccctctttgcggagaatcgagaccaagatgtggaacagtggattcgaa
agctttggcagctccaactacgggggagctggcggctacacgcagtccccggggggcttt
ggatcgcccggaccttctcaggccgaaaagaaatcaagagcccgagcccagcacattgtg
ccctgcactatatctcagctgctttctgccactttggttgatgaagtgttcagaattggg
aatgttgagatttcacaggtcactattgtggggatcatcagacatacagagaaggcccca
accaacatagtttacaaaatagatgacatgacagctccacccatggatgttcgccagtgg
gttgacacagatgacgccagcagtgaaaacactgtggttcctccagaaacatatgtgaaa
gtggcaggccacctgagatcttttcagaacaaaaagagcctggtagcctttaagatcatg
cccctggaggatatgaatgagttcactgcacatattctagaagtgattaatgcacacatg
atattaagcaaagccagtggtcagccctcagcagggaaagcacccatcagcaatccagga
atgagtgaagcagggaactttggtgggaatagctttatgccagcaaatggcctcactgtg
gcccaaaatcaggtgctgaatttgattaaggcttgtccaagacctgaagggttgaacttt
caagagctcaggaaccagctgaaacacatgtctgtaccctcaatcaagcaagctgtggat
tttctgagcaatgaggggcacatctattctactgtggatgatgatcattttaaatccaca
gatgcagaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396287Help
Entry
100396287         CDS       T03264                                 

Gene name
RPA4
Definition
(RefSeq) replication protein A4
  KO
K10741  replication factor A4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc03420  Nucleotide excision repair
cjc03430  Mismatch repair
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100396287 (RPA4)
   03420 Nucleotide excision repair
    100396287 (RPA4)
   03430 Mismatch repair
    100396287 (RPA4)
   03440 Homologous recombination
    100396287 (RPA4)
   03460 Fanconi anemia pathway
    100396287 (RPA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100396287 (RPA4)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100396287 (RPA4)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100396287 (RPA4)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100396287 (RPA4)
   MMR (mismatch excision repair)
     100396287 (RPA4)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100396287 (RPA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2
Motif
Other DBs
NCBI-GeneID: 100396287
NCBI-ProteinID: XP_008987828
Position
X
AA seq 261 aa AA seqDB search
MSKSGFGSYGSISAASGASGGSDQPSERGAAPVVKTQRPRVRIQNIVPCNVYQLLSSTVL
DTVFKVRGITVSQVSVVGVIREAEKASNHICYKIDDMTAKPIEARQWFGREKVKQLTPLS
VGLYVKVFGILKCPAGTKSLEVLKIYVLEDMNEFTVHILETVSAHMMLYKARGDTTLESV
PVSPSEVDDAGDNDESRRNFIRDEVLRLIHECPRQEGRSIHELQAQLCDLSIQAIKEVID
YLTLEGHIYPTVDREHFKSAD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagtgggtttgggagctatggcagtatttctgctgccagtggagcgagtgga
ggcagtgaccaaccatctgagagaggtgcagctcctgttgttaagacccaaagaccgagg
gtccgaatccagaacatcgtaccgtgtaatgtgtaccagctgctgagctctactgtgttg
gatactgtgttcaaggttaggggaattacagtttcccaggtctccgtcgtgggggtaatc
agagaggcagagaaggcttcaaatcacatttgttacaaaattgatgatatgactgcgaag
ccaatcgaggcccgacagtggtttggtagagagaaagtcaagcagctgactccactgtca
gtcggactatatgtgaaagtgtttggtatcctcaaatgtcccgcgggaaccaagagcctt
gaagtattgaaaatctatgtccttgaggacatgaatgaattcaccgtgcatattctggaa
acggtcagtgcacacatgatgctgtataaagcccgtggtgataccactctagaaagtgtg
cctgtgtctccatcagaagtagatgatgctggggataatgatgagagtcgccgcaatttc
atccgggatgaagtgctgcgtttgattcacgagtgccctcgtcaggaagggaggagcatc
catgagctccaggctcagctctgcgacctcagcatccaggccatcaaggaagtgattgat
tatctgaccctcgagggccacatctatcccactgtggatcgggagcattttaagtctgct
gattga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402829Help
Entry
100402829         CDS       T03264                                 

Gene name
RPA1
Definition
(RefSeq) replication protein A1
  KO
K07466  replication factor A1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc03420  Nucleotide excision repair
cjc03430  Mismatch repair
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100402829 (RPA1)
   03420 Nucleotide excision repair
    100402829 (RPA1)
   03430 Mismatch repair
    100402829 (RPA1)
   03440 Homologous recombination
    100402829 (RPA1)
   03460 Fanconi anemia pathway
    100402829 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100402829 (RPA1)
   03032 DNA replication proteins [BR:cjc03032]
    100402829 (RPA1)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100402829 (RPA1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Other Cys4 zinc finger factors
    100402829 (RPA1)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100402829 (RPA1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100402829 (RPA1)
   MMR (mismatch excision repair)
     100402829 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100402829 (RPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon IBR
Motif
Other DBs
NCBI-GeneID: 100402829
NCBI-ProteinID: XP_002747872
Ensembl: ENSCJAG00000001848
UniProt: F7EMG6
Position
5
AA seq 616 aa AA seqDB search
MVGQLSEGAIAVIMQQQDTSIKPMLQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNTLVEQGQLASNCVCQVNRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
GHGQQQVAPPPVPAASPASSKPQPQNGSSGVGSTLPKAYGASKTFGKAGGPSLSSTSGGT
QAKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESAEIRATAFNE
QVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQF
DFTGIDNLESKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATL
WGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIVNPDIPEAYKLRGWFDSEGQ
ALDGVSISDLKSGGLGGSSTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQA
CPTQDCNKKVIDQQNGLYRCEKCDTEFPSFKYRMILSVNIADFQENQWVTCFQESAEAIL
GQSAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYR
EYGRRLVQSIRRNASM
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccaactgagtgagggggccattgcggtcataatgcagcagcaggatacatcc
atcaaacccatgctccaggtcattaacatccgtcccatcaccacagggaacagtccgcca
cgttatcgactgctcatgagtgatggattgaacactttgtcatctttcatgttggccaca
cagttgaacactcttgttgaacaaggacaattggccagcaactgcgtttgccaggttaac
cgattcattgtgaacaccctgaaagacggaaggagagtagttattttgatggaattagaa
gttttgaaatcagctgaagcagttggagtgaagattggcaatccagtgccctataatgaa
ggacatgggcaacagcaggtggctcctcctccagttccagctgccagcccagctagcagc
aagccccagccacagaatggaagctcgggagtgggttccactcttcctaaggcttatggt
gcatcaaagacgtttggaaaagctggaggtcccagcctgtccagcacttccgggggaaca
caagccaaagtggtacccattgccagcctcaccccttaccagtccaagtggacgatttgt
gctcgtgtcaccaacaaaagtcagatccgtacctggagcaactcccgaggagaagggaag
ctgttctctctagaactagttgatgaaagtgctgaaatcagagctacggctttcaatgag
caagtggacaagttctttcccctcattgaagtgaacaaggtgtattatttctcaaagggc
accctgaagattgctaacaaacaattcacagctgttaaaaatgactatgagatgaccttc
aataatgagacttccgtcatgccctgtgaagatgatcatcacttgcctaccgttcagttt
gatttcacagggattgataacctagagagcaagtctaaagactcacttgtcgacataatt
gggatctgcaagagctatgaagatgccacgaaaatcacagtgaggtctaacaacagagag
gttgctaagaggaatatctacttgatggacacgtcggggaaggtggtgactgctacactg
tggggggaagatgctgataaatttgatggttccagacagcctgtgctggctatcaaagga
gccagagtctcagatttcggtggacggagcctctctgtgttgtcttccagcaccatcatc
gtgaatcctgacatcccagaggcctataagcttcgtggatggtttgactcagaaggacaa
gccttagatggcgtctccatctctgatctaaagagcggtggacttggagggagcagcacc
aactggaaaaccttgtatgaggtcaaatcagagaacctgggccaaggcgacaagccggac
tactttagctccgtggccacagtggtgtatcttcgcaaagagaactgcatgtaccaggcc
tgcccaactcaggactgcaataagaaagtgattgatcagcagaatggcttataccgctgt
gagaagtgcgacactgaattccccagtttcaagtaccgcatgatcctatcggtaaatatt
gcagattttcaagagaatcagtgggtgacttgtttccaggagtctgctgaagctatcctt
ggacaaagtgctgcctatcttggagaattaaaagacaagaatgaacaggcgtttgaagaa
gttttccagaatgccaacttccgatccttcatattccgagtcagggtcaaagtagagacc
tacaatgacgagtctcgaattaaggccactgtgatggatgtgaagcctgtggactacaga
gagtatggcagaaggctggtccagagcatccggagaaatgcatcaatgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405018Help
Entry
100405018         CDS       T03264                                 

Gene name
RPA3
Definition
(RefSeq) replication protein A3
  KO
K10740  replication factor A3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc03420  Nucleotide excision repair
cjc03430  Mismatch repair
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100405018 (RPA3)
   03420 Nucleotide excision repair
    100405018 (RPA3)
   03430 Mismatch repair
    100405018 (RPA3)
   03440 Homologous recombination
    100405018 (RPA3)
   03460 Fanconi anemia pathway
    100405018 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100405018 (RPA3)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100405018 (RPA3)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100405018 (RPA3)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100405018 (RPA3)
   MMR (mismatch excision repair)
     100405018 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100405018 (RPA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_3 DUF356
Motif
Other DBs
NCBI-GeneID: 100405018
NCBI-ProteinID: XP_002751625
Ensembl: ENSCJAG00000000705
UniProt: F6ZI81
Position
8
AA seq 121 aa AA seqDB search
MVDMMELPRARMNVSMLTQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNVTIELMEPLD
EEISGIIEVVGKVTAKATIMCTSFVQFKEDNHPFDLGLYNEAVKIIHEFPQFYPLGIVQH
D
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtggatatgatggagttgcccagggcgcgcatgaacgtcagcatgctaactcagttc
atcgacaagcctgtctgcttcgtagggaggctggaaaagattcatcccaccggaaaaatg
tttattctttcagatggagaaggaaaaaatgtaaccatcgagttgatggaacctcttgat
gaagaaatatctggaattatagaagtggttggaaaagtaaccgctaaggcaaccatcatg
tgtacatcttttgtccagtttaaagaagataaccatccttttgatcttggactttacaat
gaagctgtgaaaattatccatgagttccctcagttttatcctttagggattgtgcaacat
gactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103788971Help
Entry
103788971         CDS       T03264                                 

Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc03420  Nucleotide excision repair
cjc03430  Mismatch repair
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103788971
   03420 Nucleotide excision repair
    103788971
   03430 Mismatch repair
    103788971
   03440 Homologous recombination
    103788971
   03460 Fanconi anemia pathway
    103788971
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    103788971
   03400 DNA repair and recombination proteins [BR:cjc03400]
    103788971
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    103788971
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     103788971
   MMR (mismatch excision repair)
     103788971
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     103788971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C TFA2_Winged_2 MarR_2
Motif
Other DBs
NCBI-GeneID: 103788971
NCBI-ProteinID: XP_008982611
Ensembl: ENSCJAG00000033849
Position
18
AA seq 271 aa AA seqDB search
MMWNSGFESFGSSSYGGAGGYTQSPGGFGSPGPSQAEKKSRARAQHIVPCTISQLLSATL
VDEVFRIGNVEISQVTIVGIIRHTEKAPTNIVYKIDDMTAPPMDVRQWVDTDDASSENTV
VPPETYWKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTAHILEVINAHMILSKASGQPSAG
KAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQELRNQLKHMSV
PSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaacagtggattcgaaagctttggcagctccagctacgggggagctggcggc
tacacgcagtccccggggggctttggatcgcccggaccttctcaggccgaaaagaaatca
agagcccgagcccagcacattgtgccctgcactatatctcagctgctttctgccactttg
gttgatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatc
atcagacatacagagaaggccccaaccaacatagtttacaaaatagatgacatgacagct
ccacccatggatgttcgccagtgggttgacacagatgacgccagcagtgaaaacactgtg
gttcctccagaaacatattggaaagtggcaggccacctgagatcttttcagaacaaaaag
agcctggtagcctttaagatcatgcccctggaggatatgaatgagttcactgcacatatt
ctagaagtgattaatgcacacatgatattaagcaaagccagtggtcagccctcagcaggg
aaagcacccatcagcaatccaggaatgagtgaagcagggaactttggtgggaatagcttt
atgccagcaaatggcctcactgtggcccaaaatcaggtgctgaatttgattaaggcttgt
ccaagacctgaagggttgaactttcaagagctcaggaaccagctgaaacacatgtctgta
ccctcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtg
gatgatgatcattttaaatccacagatgcagaataa

DBGET integrated database retrieval system