KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394145Help
Entry
100394145         CDS       T03264                                 

Gene name
ITGB1
Definition
(RefSeq) integrin subunit beta 1
  KO
K05719  integrin beta 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04145  Phagosome
cjc04151  PI3K-Akt signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04514  Cell adhesion molecules (CAMs)
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04810  Regulation of actin cytoskeleton
cjc05100  Bacterial invasion of epithelial cells
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05222  Small cell lung cancer
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100394145 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100394145 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100394145 (ITGB1)
   04514 Cell adhesion molecules (CAMs)
    100394145 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100394145 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100394145 (ITGB1)
   04530 Tight junction
    100394145 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100394145 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100394145 (ITGB1)
   04670 Leukocyte transendothelial migration
    100394145 (ITGB1)
  09158 Development
   04360 Axon guidance
    100394145 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394145 (ITGB1)
   05205 Proteoglycans in cancer
    100394145 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100394145 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100394145 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100394145 (ITGB1)
   05414 Dilated cardiomyopathy (DCM)
    100394145 (ITGB1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100394145 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100394145 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100394145 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100394145 (ITGB1)
   05140 Leishmaniasis
    100394145 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100394145 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100394145 (ITGB1)
   04515 Cell adhesion molecules [BR:cjc04515]
    100394145 (ITGB1)
   04090 CD molecules [BR:cjc04090]
    100394145 (ITGB1)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100394145 (ITGB1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100394145 (ITGB1)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin beta subunits
   100394145 (ITGB1)
CD molecules [BR:cjc04090]
 Proteins
  100394145 (ITGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 100394145
NCBI-ProteinID: XP_017829668
Ensembl: ENSCJAG00000013701
Position
7
AA seq 801 aa AA seqDB search
MNLQLIFWIGLISSVCCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SSNSSNVIQLIIDAYNSLSSEVILENSKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDAFKIRPLGFTEEVEVILQYICECECQSEGIPGSPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECICGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECYPNYTGSACDCSLDTSTCV
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSYFNITKVESREKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEIMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKTGL
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaactcattttctggattggactgatcagttcagtttgctgtgtgtttggc
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcaggaccaaattgtgggtggtgcacaaattcaacatttttacaagaaggaatgcctact
tctgcacgatgtgatgacttagaagccttaaaaaagaaaggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaatcgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacgttaaaattcaagagagctgaagac
tatcctattgacctctactaccttatggacctgtcttactcaatgaaagatgatttagag
aatgtaaaaagtcttggaacagatctgatgaacgaaatgaggaggattacttctgacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaatccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgcttagtcttactaataaaggagaagtatttaatgaacttgtaggaaaacagcgc
atatctggtaatttggattctccagaaggtggttttgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacccggctgctggtgttttccacagatgct
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaacaatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactcagtgaaaataatattcagacgattttcgcagttactgaagag
tttcagcctgtttacaaggaactgaaaaacttgatccccaagtcagcagtaggaacatta
tcttcaaattctagcaatgtaattcagttgatcattgacgcatacaattccctttcctca
gaagtcattttggaaaacagcaaattatcagaaggagtaacaataagttacaaatcttac
tgcaagaatggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcagtttgaaattagcataacttcaaataaatgtccaaaaaaggattct
gacgcctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccccggaagtcccaagtgtcatgaagga
aacgggacgtttgagtgtggcgcatgcaggtgcaacgaggggcgtgttggtaggcattgt
gaatgcagcacagatgaagtcaacagtgaagatatggacgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcatctgtggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgctaccccaactacactggcagtgcgtgtgactgttctttggatactagtacttgcgta
gccagcaacggacagatctgcaatggtcggggcatctgtgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgtgcacaggaatgttcatattttaacattaccaaggtagaaagtcgggaaaaattgccc
cagccagtccaacctgatcctgtctcccattgtaaggagaaagatgttgatgactgttgg
ttctatttcacatactcagtgaatggaaacaacgagattatggttcatgttgtggagaat
ccagagtgtcctacaggtccagatatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgaccga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgcaagaaaat
ccgatatacaagagtcctattaataatttcaagaatccaaactacggacgtaaaactggt
ctctaa

DBGET integrated database retrieval system